DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpD and skr-17

DIOPT Version :9

Sequence 1:NP_608357.2 Gene:SkpD / 32995 FlyBaseID:FBgn0026174 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_001379551.1 Gene:skr-17 / 174257 WormBaseID:WBGene00004823 Length:180 Species:Caenorhabditis elegans


Alignment Length:144 Identity:45/144 - (31%)
Similarity:76/144 - (52%) Gaps:6/144 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IKLESSDGVIFSTEVKAAKLSETIKTMLEVSAVEND---ENAVVPLPKVNAFILNKILTWAYHHK 67
            ::|.||||.:...:::|..||.|:...:.....:.:   |...||:..|..|.|..::.|...||
 Worm    25 LQLTSSDGHLLQGDIRALLLSSTLAATIRELGYDKEYCAELKPVPVNNVVGFTLKLLIEWCDKHK 89

  Fly    68 DDDDQAAEGEELTPQSPHDISPWDANFIN-VDQPILFEITVAANYLEIKGLEDLCCKTLANMIRG 131
            :||...|..|:  .:....|..||.:|:: :....||::..||.:|::.||.:..|||:||..:|
 Worm    90 EDDPAIALAEK--DKKNICIPSWDRHFLSRLPMSNLFDLITAAYHLDVTGLINYGCKTVANSAKG 152

  Fly   132 KTPEEIRQTFNIED 145
            |..||:|:.|.|.:
 Worm   153 KNAEEMRELFGIPE 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpDNP_608357.2 Skp1 6..114 CDD:214704 31/111 (28%)
Skp1 88..>147 CDD:279768 22/59 (37%)
skr-17NP_001379551.1 BTB_POZ_SKP1 24..150 CDD:349631 38/126 (30%)
Skp1 137..>166 CDD:396171 14/28 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160668
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.