DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpD and skr-1

DIOPT Version :9

Sequence 1:NP_608357.2 Gene:SkpD / 32995 FlyBaseID:FBgn0026174 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_492513.1 Gene:skr-1 / 172775 WormBaseID:WBGene00004807 Length:176 Species:Caenorhabditis elegans


Alignment Length:151 Identity:68/151 - (45%)
Similarity:95/151 - (62%) Gaps:4/151 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IKLESSDGVIFSTEVKAAKLSETIKTMLEVSAVENDE--NA-VVPLPKVNAFILNKILTWAYHHK 67
            ||:.|||..||.......:||.||.|:|....::::|  || .:|:..|.|.||.|:::|..|| 
 Worm    16 IKISSSDNEIFLVPRNVIRLSNTINTLLMDLGLDDEEGTNAEPIPVQNVTASILKKVISWCNHH- 79

  Fly    68 DDDDQAAEGEELTPQSPHDISPWDANFINVDQPILFEITVAANYLEIKGLEDLCCKTLANMIRGK 132
            ..|..:.|..:...:...||..||..|:.|||..|||:.:|||||:||||.|:.|||:||||:||
 Worm    80 HSDPISTEDSDNREKRTDDIGSWDVEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGK 144

  Fly   133 TPEEIRQTFNIEDDLPIDTAE 153
            :|||||:||||::|...:..|
 Worm   145 SPEEIRRTFNIKNDFTPEEEE 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpDNP_608357.2 Skp1 6..114 CDD:214704 43/110 (39%)
Skp1 88..>147 CDD:279768 37/58 (64%)
skr-1NP_492513.1 Skp1 13..126 CDD:214704 43/110 (39%)
SKP1 16..176 CDD:227528 68/151 (45%)
Skp1 101..174 CDD:279768 39/65 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160662
Domainoid 1 1.000 56 1.000 Domainoid score I7318
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S272
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X346
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.810

Return to query results.
Submit another query.