DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpD and skr-2

DIOPT Version :9

Sequence 1:NP_608357.2 Gene:SkpD / 32995 FlyBaseID:FBgn0026174 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_492512.1 Gene:skr-2 / 172773 WormBaseID:WBGene00004808 Length:174 Species:Caenorhabditis elegans


Alignment Length:156 Identity:67/156 - (42%)
Similarity:97/156 - (62%) Gaps:9/156 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IKLESSDGVIFSTEVKAAKLSETIKTMLEVSAVENDE--NA-VVPLPKVNAFILNKILTWAYHHK 67
            ||:.|||..||.......:||.|:.|:|....:::||  || .:|:..|.|.||.|::.|...|:
 Worm    16 IKISSSDDEIFLVPRNVIRLSNTLNTLLVDLGLDDDEGTNAEPIPVQNVTASILKKVINWCTKHQ 80

  Fly    68 DDDDQAAEGEELTPQSPHDISPWDANFINVDQPILFEITVAANYLEIKGLEDLCCKTLANMIRGK 132
            .|.....:.|:.|..|   |..||..|:::||..|||:.:|||||:||||.|:.|:::||||:||
 Worm    81 SDPIPTEDSEKKTDGS---IQDWDKKFLDIDQGTLFELILAANYLDIKGLLDVACQSVANMIKGK 142

  Fly   133 TPEEIRQTFNIEDDLPIDTAELGEDL 158
            :|:|||:.|||:||.   |||..|.:
 Worm   143 SPDEIRRAFNIKDDF---TAEEREQI 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpDNP_608357.2 Skp1 6..114 CDD:214704 42/110 (38%)
Skp1 88..>147 CDD:279768 33/58 (57%)
skr-2NP_492512.1 SKP1 16..174 CDD:227528 67/156 (43%)
Skp1 16..124 CDD:214704 42/110 (38%)
Skp1 99..172 CDD:279768 38/70 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160671
Domainoid 1 1.000 56 1.000 Domainoid score I7318
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S272
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X346
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.770

Return to query results.
Submit another query.