DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpD and CG43089

DIOPT Version :9

Sequence 1:NP_608357.2 Gene:SkpD / 32995 FlyBaseID:FBgn0026174 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_001246606.1 Gene:CG43089 / 12798588 FlyBaseID:FBgn0262535 Length:144 Species:Drosophila melanogaster


Alignment Length:144 Identity:34/144 - (23%)
Similarity:72/144 - (50%) Gaps:21/144 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IKLESSDGVIFSTEVKAAKLSETIKTMLEVSAVEN-DENAVVPLPKVNAFILNKILTWAYHHKD- 68
            |:|:::||||.:.:::.|.....::.|:.....:| ..:.|:|||:|:|..|..|:.|....:: 
  Fly     9 IQLQTNDGVIHTVDMRFALQICPVRNMIMQERQKNLHTDDVIPLPRVDAKNLRFIIKWWTSVQNL 73

  Fly    69 DDDQAAEGEE-----LTPQSPHDISPWDANFINVDQPILFEITVAANYLEIKGLEDLCCKTLANM 128
            |::....|:.     ||.:             :.:...|.:|.:||:||:::....:....:|:.
  Fly    74 DENLLTMGKRKLKQLLTAE-------------HANHQFLLQIILAADYLQMEKFLLISTHLMADA 125

  Fly   129 IRG-KTPEEIRQTF 141
            :.. ::.||||:.|
  Fly   126 LNECESVEEIRRKF 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpDNP_608357.2 Skp1 6..114 CDD:214704 28/114 (25%)
Skp1 88..>147 CDD:279768 12/55 (22%)
CG43089NP_001246606.1 BTB 9..111 CDD:295341 28/114 (25%)
Skp1 95..>139 CDD:279768 11/43 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.