DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpD and LOC103691088

DIOPT Version :9

Sequence 1:NP_608357.2 Gene:SkpD / 32995 FlyBaseID:FBgn0026174 Length:158 Species:Drosophila melanogaster
Sequence 2:XP_038945796.1 Gene:LOC103691088 / 103691088 RGDID:9368177 Length:112 Species:Rattus norvegicus


Alignment Length:114 Identity:32/114 - (28%)
Similarity:51/114 - (44%) Gaps:19/114 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DAPTIKLESSDGVIFSTEVKAAKLSETIKTMLEVSA--VENDENAVVPLPKVNAFILNKILTWAY 64
            ||..:||.||||..|..:.:.|..|.|||.||....  .||:.|. |...::.:..|:|:..:..
  Rat    15 DAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNE-VNFREIPSHALSKVCMYFT 78

  Fly    65 HHKDDDDQAAEGEELTPQSPHDISPWDANFINVDQPILFEITVAANYLE 113
            :.....:.:.|    .|:.|  |:|          .|..|:.:|.|:|:
  Rat    79 YRVRYTNSSTE----IPEFP--IAP----------EIALELLMAENFLD 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpDNP_608357.2 Skp1 6..114 CDD:214704 30/110 (27%)
Skp1 88..>147 CDD:279768 6/26 (23%)
LOC103691088XP_038945796.1 BTB_POZ_EloC 18..112 CDD:349630 30/111 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.