DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zld and GFI1B

DIOPT Version :9

Sequence 1:NP_001285466.1 Gene:zld / 32994 FlyBaseID:FBgn0259789 Length:1596 Species:Drosophila melanogaster
Sequence 2:NP_001358837.1 Gene:GFI1B / 8328 HGNCID:4238 Length:352 Species:Homo sapiens


Alignment Length:432 Identity:101/432 - (23%)
Similarity:148/432 - (34%) Gaps:124/432 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly  1045 QALILADSLPHSSSSPTSSSPPPTMPMPLTTITAPQLLPLQPPPPHITSTMPMPPTMHMPIMPPP 1109
            ::.::.....|:...|......|..|..||.:          |.....|..|:..|:.      |
Human     3 RSFLVKSKKAHTYHQPRVQEDEPLWPPALTPV----------PRDQAPSNSPVLSTLF------P 51

  Fly  1110 PQCYQQLQPLDPTMSYHTIIGSGPEAHTGTAGGGYSNQITTSDGQILQLMPTSLFAPYAPLSPYS 1174
            .||      ||     .|.:...||..              .|..:.::.|    ||..|:    
Human    52 NQC------LD-----WTNLKREPELE--------------QDQNLARMAP----APEGPI---- 83

  Fly  1175 VAAQRSPQEG-----DLPPVH-------TL-TTALHAHQQ-----------------GGQQEAQT 1209
              ....||:|     |.||.:       || ||..|:::|                 |......|
Human    84 --VLSRPQDGDSPLSDSPPFYKPSFSWDTLATTYGHSYRQAPSTMQSAFLEHSVSLYGSPLVPST 146

  Fly  1210 PTLTVLSTPYSPTVSSSR--------ATP-ALEMDMATLMQHHQDYEMEQYQMQHQQLDQMQQHQ 1265
            ......|..|||.:.:..        :|| .||:.:.......:.:..:...........::|| 
Human   147 EPALDFSLRYSPGMDAYHCVKCNKVFSTPHGLEVHVRRSHSGTRPFACDICGKTFGHAVSLEQH- 210

  Fly  1266 QQLDHQQQQQILADQTQTMAQQPLAKKRRGGNATPSTTKRRRNSSVGSTSPHSTTLPSGRIKCLE 1330
               .|...|.|.|..:...|..|         ..|...::.|:                 .:|..
Human   211 ---THVHSQGIPAGSSPEPAPDP---------PGPHFLRQERS-----------------FECRM 246

  Fly  1331 CDKEFTKNCYLTQHNKSFHSGEYPFRCQKCGKRFQSEDVYTTHLGRHRTQDKPHKCELCPKQFHH 1395
            |.|.|.::..|:.| ...||...|:.||.|||||..:.....|...| |.:|||||::|.|.|..
Human   247 CGKAFKRSSTLSTH-LLIHSDTRPYPCQFCGKRFHQKSDMKKHTYIH-TGEKPHKCQVCGKAFSQ 309

  Fly  1396 KTDLRRHVEAIHTGLKQHMCDICEKGFCRKDHLRKHLET-HN 1436
            .::|..|... |||.|...|::|.|||.||..||:|.|: ||
Human   310 SSNLITHSRK-HTGFKPFSCELCTKGFQRKVDLRRHRESQHN 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zldNP_001285466.1 zf-C2H2_jaz 552..577 CDD:288983
LIM 1328..1389 CDD:259829 24/60 (40%)
C2H2 Zn finger 1328..1349 CDD:275368 6/20 (30%)
C2H2 Zn finger 1357..1377 CDD:275368 8/19 (42%)
C2H2 Zn finger 1386..1407 CDD:275368 6/20 (30%)
zf-H2C2_2 1398..1422 CDD:290200 9/23 (39%)
zf-C2H2 1413..1435 CDD:278523 11/22 (50%)
C2H2 Zn finger 1415..1435 CDD:275368 11/20 (55%)
GFI1BNP_001358837.1 C2H2 Zn finger 165..186 CDD:275368 4/20 (20%)
C2H2 Zn finger 194..214 CDD:275368 3/23 (13%)
C2H2 Zn finger 244..264 CDD:275368 6/20 (30%)
COG5048 252..>329 CDD:227381 29/79 (37%)
C2H2 Zn finger 272..292 CDD:275368 8/19 (42%)
zf-H2C2_2 284..309 CDD:372612 11/25 (44%)
C2H2 Zn finger 300..320 CDD:275368 6/20 (30%)
C2H2 Zn finger 328..345 CDD:275368 9/16 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.