DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zld and CG4730

DIOPT Version :9

Sequence 1:NP_001285466.1 Gene:zld / 32994 FlyBaseID:FBgn0259789 Length:1596 Species:Drosophila melanogaster
Sequence 2:NP_001262965.1 Gene:CG4730 / 43099 FlyBaseID:FBgn0039355 Length:392 Species:Drosophila melanogaster


Alignment Length:326 Identity:59/326 - (18%)
Similarity:113/326 - (34%) Gaps:119/326 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly  1204 QQEAQTPTLTVLSTPYSPTVSSSRATPALEM-----------------------DMATLMQHHQD 1245
            ::.|:.|...|     |..||.|.:|.:||:                       |....:.::..
  Fly    18 RRTAEAPVKLV-----SHEVSLSDSTTSLELSNCCRLCLEEPYPNQMLDMTVIYDQEAALSYYDC 77

  Fly  1246 YEM--------------------------------EQYQMQHQQLDQM----QQHQQQLDHQQQQ 1274
            ||:                                ::..:.:|||.::    :.:.:|.|..:.:
  Fly    78 YEICTKEDLRQNPKNEPRTLCKRCAVELKWAYDFHKKMAIANQQLREIFVATEANTEQEDDVEDE 142

  Fly  1275 QILADQTQTMAQQPLAKKRRGGNATP-----STTKRRRNSSVGSTSPHSTTLPSGRIKCLECDKE 1334
            :..||..:....:.:.:|:.    ||     ....|.|:              :|:..|..|.||
  Fly   143 ENEADMNEEFLMEEIEEKQE----TPIDSLEDIVPRNRH--------------TGKSNCKFCHKE 189

  Fly  1335 FTKNCYLTQHNKSFHSGEYP-FRCQKCGKRFQSEDVYTTHLG----------------------- 1375
            |..:..:.:| :..|....| |||.:|.:.:.::.....|:.                       
  Fly   190 FRNHSRMAKH-QMIHLANRPNFRCSQCDRVYLTKQALKVHVDSKHRQSGVHCDTCGKVFAIAKAL 253

  Fly  1376 ----RHRTQDKPHKCELCPKQFHHKTDLRRHVEAIHTGLKQHMCDI--CEKGFCRKDHLRKHLET 1434
                |:..:|.|:.|:||.::|..::.|..|.:..|:| .:.:|:.  |:|.|.....||.|..|
  Fly   254 EIHKRYHNRDFPYSCDLCDRRFAQRSHLTVHQQVKHSG-SRFICEFPGCQKSFTSSSSLRNHECT 317

  Fly  1435 H 1435
            |
  Fly   318 H 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zldNP_001285466.1 zf-C2H2_jaz 552..577 CDD:288983
LIM 1328..1389 CDD:259829 17/88 (19%)
C2H2 Zn finger 1328..1349 CDD:275368 6/20 (30%)
C2H2 Zn finger 1357..1377 CDD:275368 3/46 (7%)
C2H2 Zn finger 1386..1407 CDD:275368 6/20 (30%)
zf-H2C2_2 1398..1422 CDD:290200 7/25 (28%)
zf-C2H2 1413..1435 CDD:278523 7/23 (30%)
C2H2 Zn finger 1415..1435 CDD:275368 7/21 (33%)
CG4730NP_001262965.1 zf-AD 46..124 CDD:285071 6/77 (8%)
C2H2 Zn finger 183..203 CDD:275368 6/20 (30%)
C2H2 Zn finger 212..232 CDD:275368 3/19 (16%)
C2H2 Zn finger 240..260 CDD:275368 1/19 (5%)
C2H2 Zn finger 268..289 CDD:275368 6/20 (30%)
C2H2 Zn finger 296..318 CDD:275368 7/21 (33%)
C2H2 Zn finger 325..346 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457227
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.