DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zld and esg

DIOPT Version :9

Sequence 1:NP_001285466.1 Gene:zld / 32994 FlyBaseID:FBgn0259789 Length:1596 Species:Drosophila melanogaster
Sequence 2:NP_476600.1 Gene:esg / 34903 FlyBaseID:FBgn0001981 Length:470 Species:Drosophila melanogaster


Alignment Length:567 Identity:119/567 - (20%)
Similarity:184/567 - (32%) Gaps:217/567 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   997 PQQQLVHHYQA-------VLHPLHQQLGEQHQRQEADHHQQQRELHQLDQQQQQQQALILADSLP 1054
            |.::|::....       |.|...:.:.|:.:..:.|          :|....|.||..||.:..
  Fly    55 PSEELINVSDCCEDEGVDVDHTDDEHIEEEDEDVDVD----------VDSDPNQTQAAALAAAAA 109

  Fly  1055 HSSSSPTS-SSPPPTMP---------MPLT-----TIT--APQLLPLQ----------------- 1085
            .::::..| ..|.||.|         .|.|     ||.  ..|:|||:                 
  Fly   110 VAAAAAASVVVPTPTYPKYPWNNFHMSPYTAEFYRTINQQGHQILPLRGDLIAPSSPSDSLGSLS 174

  Fly  1086 PPPPHI---TSTMPMPP----TMHMPI------MPPPPQCYQQLQPLDPTMSYHTIIGSGPEAHT 1137
            |||.|.   .::...||    .:|.||      ..|.||     .|..|::              
  Fly   175 PPPHHYLHGRASSVSPPMRSEIIHRPIGVRQHRFLPYPQ-----MPGYPSL-------------- 220

  Fly  1138 GTAGGGYSNQITTSDGQILQLMPTSLFAPYAPLSPYSVAAQRSPQEGDLPPVHTLTTALHAHQQG 1202
                |||                |.....:||:||                         |:.:.
  Fly   221 ----GGY----------------THTHHHHAPISP-------------------------AYSEN 240

  Fly  1203 GQQEAQTPTLTVLSTPYSPTVSSSRATPALEMDMATLMQHHQDYEMEQYQMQHQQLDQMQQHQQQ 1267
            .....::.|         |..|.|.:.|                  |...::|:.|:      ..
  Fly   241 SYYSMRSMT---------PESSCSSSLP------------------EDLSLKHKNLN------LN 272

  Fly  1268 LDHQQQQQILADQTQTMAQQ--PLAKKRRGGNATPSTTKRRRNSSVGSTSPHSTTLPSGRIKCLE 1330
            |:..|..:..|.:|..|:.:  |.|..::..|..|                        |.:|.:
  Fly   273 LNTSQPGEQAAAKTGDMSPETMPNASAKKDKNQPP------------------------RYQCPD 313

  Fly  1331 CDKEFTKNCYLTQHNKSFH-------SGEYPFRCQKCGKRFQSEDVYTTHLGRHRTQDKPHKCEL 1388
            |.|.::....||:| :.||       ..:..|.|:.|.|.:.|......|:   ||...|.||.|
  Fly   314 CQKSYSTFSGLTKH-QQFHCPAAEGNQVKKSFSCKDCDKTYVSLGALKMHI---RTHTLPCKCNL 374

  Fly  1389 CPKQFHHKTDLRRHVEAIHTGLKQHMCDICEKGFCRKDHLRKHLETHNRPRVVGKKSAAAAAAAA 1453
            |.|.|.....|:.|:.. |||.|...|..|.:.|..:.:||.||:||:.   :.|.|..:.:...
  Fly   375 CGKAFSRPWLLQGHIRT-HTGEKPFSCQHCHRAFADRSNLRAHLQTHSD---IKKYSCTSCSKTF 435

  Fly  1454 AAAAVTATAGLGGAP--AAGSIKAAFARSLTVTAVSSEPG-AGVAIP 1497
            :..::......||.|  :|||            :.|||.. ||.|.|
  Fly   436 SRMSLLTKHSEGGCPGGSAGS------------SSSSELNYAGYAEP 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zldNP_001285466.1 zf-C2H2_jaz 552..577 CDD:288983
LIM 1328..1389 CDD:259829 19/67 (28%)
C2H2 Zn finger 1328..1349 CDD:275368 6/20 (30%)
C2H2 Zn finger 1357..1377 CDD:275368 5/19 (26%)
C2H2 Zn finger 1386..1407 CDD:275368 7/20 (35%)
zf-H2C2_2 1398..1422 CDD:290200 8/23 (35%)
zf-C2H2 1413..1435 CDD:278523 7/21 (33%)
C2H2 Zn finger 1415..1435 CDD:275368 7/19 (37%)
esgNP_476600.1 zf-C2H2 309..331 CDD:278523 6/22 (27%)
C2H2 Zn finger 311..331 CDD:275370 6/20 (30%)
zf-C2H2 344..366 CDD:278523 7/24 (29%)
C2H2 Zn finger 346..366 CDD:275368 6/22 (27%)
zf-C2H2 370..392 CDD:278523 8/22 (36%)
C2H2 Zn finger 372..392 CDD:275368 7/20 (35%)
zf-H2C2_2 385..408 CDD:290200 8/23 (35%)
zf-C2H2 398..420 CDD:278523 7/21 (33%)
C2H2 Zn finger 400..420 CDD:275368 7/19 (37%)
C2H2 Zn finger 428..444 CDD:275368 0/15 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457224
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.