DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zld and erm

DIOPT Version :9

Sequence 1:NP_001285466.1 Gene:zld / 32994 FlyBaseID:FBgn0259789 Length:1596 Species:Drosophila melanogaster
Sequence 2:NP_001259891.2 Gene:erm / 326152 FlyBaseID:FBgn0031375 Length:698 Species:Drosophila melanogaster


Alignment Length:505 Identity:116/505 - (22%)
Similarity:178/505 - (35%) Gaps:148/505 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   994 MQPPQQQLVHHYQAVLHPLHQQLGEQHQRQEADHHQQQRELHQLDQQQQQQQA------------ 1046
            |.||.:..|         :.....||:..|::             |||.:|.|            
  Fly    20 MMPPSKSPV---------MESAASEQNPAQQS-------------QQQDEQSAKRACPLKFSIAK 62

  Fly  1047 LILADSLPHSSSSPTSSSPPPTMPMPLTTITAPQLLPLQP----------PPPHITSTMPMPPTM 1101
            ::..|..|        |..||..|.|::..|........|          .|..:.|....|.|:
  Fly    63 IMEPDHRP--------SQVPPPQPAPVSFATNDDDEDEDPEIDADSERSCSPIEVISLDQSPSTV 119

  Fly  1102 HMPIMPPPPQCYQQLQPLDPTMSYHTIIGSGPEAHTGTAGGGYSNQITTSDGQILQLMPTSLFAP 1166
            :.      ...:::..| .|.....:.:.|.|..      ......:::...::|...|...:||
  Fly   120 NY------DSAFKKYVP-GPCSGATSSVASPPST------AAVQQFVSSRHQELLSQYPLLYYAP 171

  Fly  1167 -----YAPLSPYSVAAQRSPQEGDLPPVH------TLTTALHAHQQGGQQEAQTPTLTVLSTPYS 1220
                 .|..:.|  ||..:.|:......|      :|..:|| |.|..::....|.....:.   
  Fly   172 NQLMCAAAAAQY--AALTAQQQSLASAAHLSSFTASLNASLH-HSQSLRRNLGHPLAAAAAV--- 230

  Fly  1221 PTVSSSRATPALEMDMATLMQHHQDYEMEQYQMQHQQLDQMQQHQQQLDHQQQQQILADQT-QTM 1284
            ..|:.|:|.|                                    .|.|..::..:|.:| |:.
  Fly   231 AAVAQSQAVP------------------------------------NLQHTLEKSPVAQRTAQSS 259

  Fly  1285 AQQPLAKKRRG----GNATP-------STTKRRRNS-----SVGSTSPHSTTLPSGRIK---CLE 1330
            ..|...|::|.    |..||       |.|..|..|     |:..:||.|.:  .|:.|   |||
  Fly   260 GLQANLKRKRSPQDQGEVTPPPASTATSATGARSRSPSPQGSIEDSSPGSAS--GGKPKTFSCLE 322

  Fly  1331 CDKEFTKNCYLTQHNKSFHSGEYPFRCQKCGKRFQSEDVYTTHLGRHRTQDKPHKCELCPKQFHH 1395
            |.|.|..:..||:| ...|:|..||.|:.|||.|:.......|...| |.:|||||:.|.|.|:.
  Fly   323 CGKVFNAHYNLTRH-MPVHTGARPFVCKVCGKGFRQASTLCRHKIIH-TSEKPHKCQTCGKAFNR 385

  Fly  1396 KTDLRRHVEAIHTGLKQHMCDICEKGFCRKDHLRKHLETHNRPRVVGKKS 1445
            .:.|..| ..||.|.|..:|:.|.|||.:|.:.:.|..||:     |:|:
  Fly   386 SSTLNTH-SRIHAGYKPFVCEYCGKGFHQKGNYKNHKLTHS-----GEKA 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zldNP_001285466.1 zf-C2H2_jaz 552..577 CDD:288983
LIM 1328..1389 CDD:259829 26/60 (43%)
C2H2 Zn finger 1328..1349 CDD:275368 9/20 (45%)
C2H2 Zn finger 1357..1377 CDD:275368 6/19 (32%)
C2H2 Zn finger 1386..1407 CDD:275368 6/20 (30%)
zf-H2C2_2 1398..1422 CDD:290200 9/23 (39%)
zf-C2H2 1413..1435 CDD:278523 7/21 (33%)
C2H2 Zn finger 1415..1435 CDD:275368 7/19 (37%)
ermNP_001259891.2 COG5048 <295..461 CDD:227381 53/145 (37%)
C2H2 Zn finger 320..340 CDD:275368 9/20 (45%)
zf-H2C2_2 332..357 CDD:290200 12/25 (48%)
zf-C2H2 346..368 CDD:278523 7/21 (33%)
C2H2 Zn finger 348..368 CDD:275368 6/19 (32%)
zf-H2C2_2 363..385 CDD:290200 11/22 (50%)
C2H2 Zn finger 376..396 CDD:275368 6/20 (30%)
zf-H2C2_2 389..413 CDD:290200 11/24 (46%)
C2H2 Zn finger 404..424 CDD:275368 7/19 (37%)
zf-H2C2_2 416..441 CDD:290200 5/19 (26%)
C2H2 Zn finger 432..452 CDD:275368
C2H2 Zn finger 460..478 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.