DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zld and lsy-2

DIOPT Version :9

Sequence 1:NP_001285466.1 Gene:zld / 32994 FlyBaseID:FBgn0259789 Length:1596 Species:Drosophila melanogaster
Sequence 2:NP_001024696.1 Gene:lsy-2 / 180522 WormBaseID:WBGene00003087 Length:365 Species:Caenorhabditis elegans


Alignment Length:217 Identity:53/217 - (24%)
Similarity:71/217 - (32%) Gaps:93/217 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly  1234 MDMATLMQHHQDYEMEQYQMQHQQLDQMQQHQQQLDHQQQQQILADQTQTMAQQPLAKKRRGGNA 1298
            ||.:.:|...|||  .||||...:.|:|.:                                |..
 Worm    42 MDDSEMMMDEQDY--SQYQMGFPEEDEMVE--------------------------------GMM 72

  Fly  1299 TPSTTKRRRNSSVGSTSPHSTTLPSGRIKCLECDKEFTKNCYLTQHNKSFHSGEYPFRCQKCGKR 1363
            ||                                             ::.|      :|..|.|.
 Worm    73 TP---------------------------------------------RAVH------QCNVCNKI 86

  Fly  1364 FQSEDVYTTHLGRHRTQDKPHKCELCPKQFHHKTDLRRHVEAIHTGLKQHMCDICEKGFCR-KDH 1427
            |.|......|...| |..||.:|::|.|.|..|::|..| .::|||...|.|..|.| .|| |.:
 Worm    87 FVSYKGLQQHAVIH-TDQKPFRCDICSKSFRFKSNLFEH-RSVHTGFTPHACPYCGK-TCRLKGN 148

  Fly  1428 LRKHLETHNRPRVVGKKSAAAA 1449
            |:|||.||    |..|:...||
 Worm   149 LKKHLRTH----VTTKEELEAA 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zldNP_001285466.1 zf-C2H2_jaz 552..577 CDD:288983
LIM 1328..1389 CDD:259829 12/60 (20%)
C2H2 Zn finger 1328..1349 CDD:275368 0/20 (0%)
C2H2 Zn finger 1357..1377 CDD:275368 6/19 (32%)
C2H2 Zn finger 1386..1407 CDD:275368 7/20 (35%)
zf-H2C2_2 1398..1422 CDD:290200 9/23 (39%)
zf-C2H2 1413..1435 CDD:278523 11/22 (50%)
C2H2 Zn finger 1415..1435 CDD:275368 10/20 (50%)
lsy-2NP_001024696.1 zf-C2H2 106..128 CDD:278523 7/22 (32%)
C2H2 Zn finger 108..128 CDD:275368 7/20 (35%)
zf-C2H2 134..156 CDD:278523 11/22 (50%)
C2H2 Zn finger 136..156 CDD:275368 10/20 (50%)
C2H2 Zn finger 80..100 CDD:275368 6/19 (32%)
zf-H2C2_2 93..115 CDD:290200 8/22 (36%)
COG5048 102..>156 CDD:227381 23/55 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166231
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.