DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zld and ZNF114

DIOPT Version :9

Sequence 1:NP_001285466.1 Gene:zld / 32994 FlyBaseID:FBgn0259789 Length:1596 Species:Drosophila melanogaster
Sequence 2:NP_001318027.1 Gene:ZNF114 / 163071 HGNCID:12894 Length:463 Species:Homo sapiens


Alignment Length:166 Identity:56/166 - (33%)
Similarity:77/166 - (46%) Gaps:18/166 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly  1270 HQQQQQILADQTQTMAQQPLAKKRRGGNATPSTTKRRRNSSVGSTSPHSTTLPSGRIKCLECDKE 1334
            |..|.|:...:|.....|           |.:|:....||  ||...|.|...:.  ||.||.:.
Human   309 HAMQMQLYTAETNKKDCQ-----------TGATSANAPNS--GSHKSHCTGEKTH--KCPECGRA 358

  Fly  1335 FTKNCYLTQHNKSFHSGEYPFRCQKCGKRFQSEDVYTTHLGRHRTQDKPHKCELCPKQFHHKTDL 1399
            |....:|.:|.| .|:||.|:.|.||||.|:.......||.:|..|.||::||.|.|.....:..
Human   359 FFYQSFLMRHMK-IHTGEKPYECGKCGKAFRYSLHLNKHLRKHVVQKKPYECEECGKVIRESSKY 422

  Fly  1400 RRHVEAIHTGLKQHMCDICEKGFCRKDHLRKHLETH 1435
             .|:.: |||.|.:.|..|.|.|.:...|:|||:||
Human   423 -THIRS-HTGEKPYKCKTCGKDFAKSSGLKKHLKTH 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zldNP_001285466.1 zf-C2H2_jaz 552..577 CDD:288983
LIM 1328..1389 CDD:259829 25/60 (42%)
C2H2 Zn finger 1328..1349 CDD:275368 7/20 (35%)
C2H2 Zn finger 1357..1377 CDD:275368 8/19 (42%)
C2H2 Zn finger 1386..1407 CDD:275368 5/20 (25%)
zf-H2C2_2 1398..1422 CDD:290200 8/23 (35%)
zf-C2H2 1413..1435 CDD:278523 8/21 (38%)
C2H2 Zn finger 1415..1435 CDD:275368 8/19 (42%)
ZNF114NP_001318027.1 KRAB 52..111 CDD:214630
KRAB 52..91 CDD:279668
zf-C2H2 350..372 CDD:278523 8/24 (33%)
C2H2 Zn finger 352..372 CDD:275368 7/20 (35%)
zf-H2C2_2 365..389 CDD:290200 13/24 (54%)
C2H2 Zn finger 380..428 CDD:275368 17/49 (35%)
Ribosomal_L37ae 388..>445 CDD:302811 19/58 (33%)
zf-H2C2_2 423..444 CDD:290200 8/21 (38%)
zf-C2H2 434..456 CDD:278523 8/21 (38%)
C2H2 Zn finger 436..456 CDD:275368 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S11783
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.