DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alr and ERV2

DIOPT Version :9

Sequence 1:NP_001259731.1 Gene:Alr / 32991 FlyBaseID:FBgn0031068 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_015362.1 Gene:ERV2 / 856152 SGDID:S000006241 Length:196 Species:Saccharomyces cerevisiae


Alignment Length:144 Identity:46/144 - (31%)
Similarity:72/144 - (50%) Gaps:14/144 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 ISNVQSAKVK----HMAAAEKLTVNAAEDPLPRDDCPLDKVR--LGISTWGLLHTMAAFYSDNPT 183
            |..||.|..:    .:...||.|:.    ||..|    |||:  :|.::|...||:.|.:.|.||
Yeast    45 IDEVQGAAAEKNDARLKEIEKQTIM----PLMGD----DKVKKEVGRASWKYFHTLLARFPDEPT 101

  Fly   184 DTEKRDMKTFFEVLSRLYPCEFCAKDFRTDLDVNPINVNSQKELALWLCKFHNRVNDKLGKPLFD 248
            ..|:..:.||..:.:.||||..|:..|...::..|:..:|:...|:|.|..||:||:.|.|.::|
Yeast   102 PEEREKLHTFIGLYAELYPCGECSYHFVKLIEKYPVQTSSRTAAAMWGCHIHNKVNEYLKKDIYD 166

  Fly   249 CTKVNERWRDGWLD 262
            |..:.|.:..|..|
Yeast   167 CATILEDYDCGCSD 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AlrNP_001259731.1 Evr1_Alr 109..260 CDD:295176 44/140 (31%)
ERV2NP_015362.1 ERV1 1..180 CDD:227387 45/142 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5054
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1026
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002981
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101299
Panther 1 1.100 - - O PTHR12645
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.720

Return to query results.
Submit another query.