DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alr and gfer

DIOPT Version :9

Sequence 1:NP_001259731.1 Gene:Alr / 32991 FlyBaseID:FBgn0031068 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001082855.1 Gene:gfer / 560433 ZFINID:ZDB-GENE-060810-186 Length:191 Species:Danio rerio


Alignment Length:206 Identity:86/206 - (41%)
Similarity:117/206 - (56%) Gaps:36/206 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 MDKEHHESPFAANRKAGASG-----AGK--QDSN--------------CRTCNDFKSWSKQQRLI 125
            |...|..||.::   ||..|     |||  :||.              ||.|.|||||.|.|:..
Zfish     1 MAAAHGSSPHSS---AGMEGFPFPVAGKPPEDSTSNDQTTTGETKKKPCRACTDFKSWMKLQKQA 62

  Fly   126 SNVQSAKVKHMAAAEKLTVNAAEDPLPRDDCPLDKVRLGISTWGLLHTMAAFYSDNPTDTEKRDM 190
            |   ||.|:.....|:|      .|:   :||||:..||.|:|..||||||:|.|.|:..::.:|
Zfish    63 S---SASVQESRPVEEL------KPV---ECPLDREELGRSSWSFLHTMAAYYPDAPSTEQQLEM 115

  Fly   191 KTFFEVLSRLYPCEFCAKDFRTDLDVNPINVNSQKELALWLCKFHNRVNDKLGKPLFDCTKVNER 255
            ..|..:.|:::||:.||:|.||.|..|..:..|:.:|:.|||:.||.:|.:||||.|||::|:||
Zfish   116 TQFINLFSKVFPCDECAEDLRTRLKTNRPDAGSRHKLSQWLCRLHNDINIRLGKPEFDCSRVDER 180

  Fly   256 WRDGWLDGSCD 266
            |||||.|||||
Zfish   181 WRDGWKDGSCD 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AlrNP_001259731.1 Evr1_Alr 109..260 CDD:295176 67/150 (45%)
gferNP_001082855.1 Evr1_Alr <60..187 CDD:295176 59/138 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587917
Domainoid 1 1.000 106 1.000 Domainoid score I6524
eggNOG 1 0.900 - - E1_COG5054
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 158 1.000 Inparanoid score I4236
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1537996at2759
OrthoFinder 1 1.000 - - FOG0002981
OrthoInspector 1 1.000 - - oto40671
orthoMCL 1 0.900 - - OOG6_101299
Panther 1 1.100 - - LDO PTHR12645
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R414
SonicParanoid 1 1.000 - - X2810
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.