DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alr and Gfer

DIOPT Version :9

Sequence 1:NP_001259731.1 Gene:Alr / 32991 FlyBaseID:FBgn0031068 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_038941245.1 Gene:Gfer / 27100 RGDID:61845 Length:312 Species:Rattus norvegicus


Alignment Length:129 Identity:48/129 - (37%)
Similarity:63/129 - (48%) Gaps:34/129 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 AANRKAGASGA---------GKQDSNCRTCNDFKSWSKQQRLISNVQSAKVKHMAAAEKLTVNAA 147
            |.:||..|..|         ||:.  ||.|.|||||.:.|      |...:|.            
  Rat   186 ARHRKDNAPAAAPAPKGLEHGKRP--CRACVDFKSWMRTQ------QKRDIKF------------ 230

  Fly   148 EDPLPRDDCPLDKVRLGISTWGLLHTMAAFYSDNPTDTEKRDMKTFFEVLSRLYPCEFCAKDFR 211
                 |:|||.|:..||.:||..|||:||:|.|.||..:::||..|..:.|:.||||.||:|.|
  Rat   231 -----REDCPQDREELGRNTWAFLHTLAAYYPDMPTPEQQQDMAQFIHIFSKFYPCEECAEDIR 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AlrNP_001259731.1 Evr1_Alr 109..260 CDD:295176 41/103 (40%)
GferXP_038941245.1 Evr1_Alr <225..>290 CDD:413197 31/82 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346537
Domainoid 1 1.000 109 1.000 Domainoid score I6251
eggNOG 1 0.900 - - E1_COG5054
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 153 1.000 Inparanoid score I4249
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1537996at2759
OrthoFinder 1 1.000 - - FOG0002981
OrthoInspector 1 1.000 - - otm45748
orthoMCL 1 0.900 - - OOG6_101299
Panther 1 1.100 - - LDO PTHR12645
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2810
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.760

Return to query results.
Submit another query.