DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alr and SPBC146.04

DIOPT Version :9

Sequence 1:NP_001259731.1 Gene:Alr / 32991 FlyBaseID:FBgn0031068 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_595393.1 Gene:SPBC146.04 / 2539721 PomBaseID:SPBC146.04 Length:192 Species:Schizosaccharomyces pombe


Alignment Length:129 Identity:34/129 - (26%)
Similarity:57/129 - (44%) Gaps:20/129 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 VQSAKVKHMAAAEKLTVNAAEDPLPRDDCPLDKVRLGISTWGLLHTMAAFYSDNPTDTEKRDMKT 192
            ::....||......|.|||                    .|.|:||:.:.|.:.||..|:..::.
pombe    54 IEMMSTKHDNNTNNLMVNA--------------------YWKLIHTVVSNYPNRPTLDERDILRH 98

  Fly   193 FFEVLSRLYPCEFCAKDFRTDLDVNPINVNSQKELALWLCKFHNRVNDKLGKPLFDCTKVNERW 256
            :....:...||...:.:.:..|||:|...:|:|....|.||.||::|:|:.:|...|...|||:
pombe    99 YLFSSAITMPCGEYSVELQKILDVHPPQTSSRKAATTWACKVHNQLNEKMNQPKTSCDGFNERY 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AlrNP_001259731.1 Evr1_Alr 109..260 CDD:295176 34/129 (26%)
SPBC146.04NP_595393.1 ERV1 1..168 CDD:227387 34/129 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5054
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002981
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101299
Panther 1 1.100 - - O PTHR12645
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.770

Return to query results.
Submit another query.