DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alr and F56C11.3

DIOPT Version :9

Sequence 1:NP_001259731.1 Gene:Alr / 32991 FlyBaseID:FBgn0031068 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_490690.1 Gene:F56C11.3 / 171611 WormBaseID:WBGene00018955 Length:161 Species:Caenorhabditis elegans


Alignment Length:164 Identity:71/164 - (43%)
Similarity:96/164 - (58%) Gaps:7/164 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 GKQDSNCRTCNDFKSWSKQQRLISNVQSAKVKHMAAAEKLTVNAAEDPLPRDDCPLDKVRLGIST 167
            |.....||.|...:...|:.|.::.    |:|   ..|..|..:.........||:||..||.||
 Worm     4 GPDGKPCRACVSVEDMMKKGREMAE----KIK---KKESETTPSTSTGAKLHGCPVDKDELGRST 61

  Fly   168 WGLLHTMAAFYSDNPTDTEKRDMKTFFEVLSRLYPCEFCAKDFRTDLDVNPINVNSQKELALWLC 232
            |.|||||:.:|.:.|||.:|...::|..:|.:.|||:|||||.|.||..:|..|.|::..|||:|
 Worm    62 WNLLHTMSVYYPEKPTDEDKDRARSFMSILGKTYPCDFCAKDLRKDLKESPPKVESREAFALWMC 126

  Fly   233 KFHNRVNDKLGKPLFDCTKVNERWRDGWLDGSCD 266
            :.||:||:|.|||.|:|..|.:||||||.|||||
 Worm   127 QLHNKVNEKTGKPKFECRDVMQRWRDGWKDGSCD 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AlrNP_001259731.1 Evr1_Alr 109..260 CDD:295176 63/150 (42%)
F56C11.3NP_490690.1 Evr1_Alr 60..148 CDD:282612 44/87 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162651
Domainoid 1 1.000 118 1.000 Domainoid score I3669
eggNOG 1 0.900 - - E1_COG5054
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 153 1.000 Inparanoid score I2940
Isobase 1 0.950 - 0 Normalized mean entropy S1026
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1537996at2759
OrthoFinder 1 1.000 - - FOG0002981
OrthoInspector 1 1.000 - - oto18263
orthoMCL 1 0.900 - - OOG6_101299
Panther 1 1.100 - - LDO PTHR12645
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R414
SonicParanoid 1 1.000 - - X2810
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.740

Return to query results.
Submit another query.