DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alr and gfer

DIOPT Version :9

Sequence 1:NP_001259731.1 Gene:Alr / 32991 FlyBaseID:FBgn0031068 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_002935903.2 Gene:gfer / 100488306 XenbaseID:XB-GENE-987617 Length:197 Species:Xenopus tropicalis


Alignment Length:183 Identity:79/183 - (43%)
Similarity:112/183 - (61%) Gaps:15/183 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 KEHHESPFAANRKAGASGAGKQDSNCRTCNDFKSWSKQQRLISNVQSAKVKHMAAAEKLTVNAAE 148
            |:..::..||....|.:.|.|:.  ||.|.|||||.:|||          :..||.::..:...|
 Frog    30 KQDGKAESAAVGGEGGTAAPKKP--CRACMDFKSWMRQQR----------RQGAAPQEAEIENKE 82

  Fly   149 DPLPRDDCPLDKVRLGISTWGLLHTMAAFYSDNPTDTEKRDMKTFFEVLSRLYPCEFCAKDFRTD 213
            .|.   :||||:..||.|:|..||||||:|.|.||:.::::|::|..:.|:.|||:.||:|.|..
 Frog    83 RPA---ECPLDREELGRSSWSFLHTMAAYYPDQPTNQQQQEMRSFINLFSKFYPCDECAEDMRER 144

  Fly   214 LDVNPINVNSQKELALWLCKFHNRVNDKLGKPLFDCTKVNERWRDGWLDGSCD 266
            |:....:.:|:..|:.|:|..||.||.||||..|||:||:|||||||.|||||
 Frog   145 LNSTQPDTSSRHNLSQWMCILHNDVNRKLGKEAFDCSKVDERWRDGWKDGSCD 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AlrNP_001259731.1 Evr1_Alr 109..260 CDD:295176 66/150 (44%)
gferXP_002935903.2 Evr1_Alr 97..187 CDD:398444 41/89 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 108 1.000 Domainoid score I6404
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 163 1.000 Inparanoid score I4107
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1537996at2759
OrthoFinder 1 1.000 - - FOG0002981
OrthoInspector 1 1.000 - - oto104314
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2810
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.