DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment parvin and ACTN1

DIOPT Version :9

Sequence 1:NP_001285464.1 Gene:parvin / 32990 FlyBaseID:FBgn0052528 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_016877209.1 Gene:ACTN1 / 87 HGNCID:163 Length:1106 Species:Homo sapiens


Alignment Length:175 Identity:41/175 - (23%)
Similarity:73/175 - (41%) Gaps:36/175 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 RAPVRLPENVFVTVVIAEKNAGVLNAQKFQEQITSEYDD----LGMRCEKDAFDTLIDCAPDKLA 257
            |.|.|..:|.         :.|:...::.:|...||...    ||.:..|..:.|          
Human    17 RNPCRKADNC---------HQGIGKGKRKEEAYKSENPKKLKWLGEKTLKRPWST---------- 62

  Fly   258 VVKKSLITFVNKHLAKLNFEISDLNTDFRDGVYLCLLMGLLGGFFVPLHEFHLTPQDVDQM---- 318
              .::...:.|.||.|...:|.::..|||||:.|.||:.::.|       ..|...:..:|    
Human    63 --SETFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISG-------ERLAKPERGKMRVHK 118

  Fly   319 VSNVAFAFDLMQDVGLPKPKARPEDIVNMDLKSTLRVLYSLFTMF 363
            :|||..|.|.:...|:.......|:||:.::|.||.:::::...|
Human   119 ISNVNKALDFIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRF 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
parvinNP_001285464.1 CH 92..192 CDD:278723
CH 258..359 CDD:278723 28/104 (27%)
ACTN1XP_016877209.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.