DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment parvin and Parvg

DIOPT Version :9

Sequence 1:NP_001285464.1 Gene:parvin / 32990 FlyBaseID:FBgn0052528 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001124055.1 Gene:Parvg / 689069 RGDID:1597417 Length:331 Species:Rattus norvegicus


Alignment Length:316 Identity:128/316 - (40%)
Similarity:197/316 - (62%) Gaps:6/316 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 EGKYAIDSPGSPSQYDIPPEDYALREHEQRAVIDPQSISDPQVIKLQRILVDWINDELAEQRIIV 111
            |.::..|....|.:...|.|:...|..::| .:.|.|..:|:..:||::|::|||..|..:.|:|
  Rat     2 ESEFLYDLLQLPKEVAQPTEEELPRGGKKR-YLSPNSKRNPKFEQLQKVLMEWINATLLPEHIVV 65

  Fly   112 QHLEEDMYDGQVLHKLWEKLTGKKLDVPEVTQSEQGQHEKLNIVLKAVNHTLGFHQKIPKWSVAS 176
            :.|||||:||.:||.|::||:..||:|.|::.:...|..||.::|:|||.:|...::..||||.:
  Rat    66 RSLEEDMFDGLILHHLFQKLSSLKLEVEEISLTSASQRRKLGVILEAVNQSLQVEEQQAKWSVET 130

  Fly   177 VHSKNIVAILHLLVALVRHFRAPVRLPENVFVTVVIAEKNAGVLNAQKFQEQIT--SEYDDLGMR 239
            :.:|:::|.|||||||.:.|:..:.||:|:.|.|:..|.....|.:.|..||:|  :.:.|   :
  Rat   131 IFNKDLLATLHLLVALAKRFQPDLPLPDNIQVEVIHIESTKMGLKSDKQVEQLTECNSHKD---Q 192

  Fly   240 CEKDAFDTLIDCAPDKLAVVKKSLITFVNKHLAKLNFEISDLNTDFRDGVYLCLLMGLLGGFFVP 304
            ..:||||.|...||:|:..||:::::|||:.|..|...:..|:|.|.|||.|.||:|.|.|||:.
  Rat   193 PSQDAFDELFRLAPEKVHAVKEAIVSFVNQKLEGLGLSVQSLDTQFADGVILLLLIGQLEGFFLH 257

  Fly   305 LHEFHLTPQDVDQMVSNVAFAFDLMQDVGLPKPKARPEDIVNMDLKSTLRVLYSLF 360
            |.||:|||....:|:.||..|.:|::|.||......||||||.|.|||||:||.||
  Rat   258 LKEFYLTPSSPTEMLHNVTLALELLKDEGLCSYPINPEDIVNKDTKSTLRILYGLF 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
parvinNP_001285464.1 CH 92..192 CDD:278723 44/99 (44%)
CH 258..359 CDD:278723 49/100 (49%)
ParvgNP_001124055.1 CH 45..146 CDD:278723 44/100 (44%)
CH 212..312 CDD:278723 49/99 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339057
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52959
OrthoDB 1 1.010 - - D373611at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12114
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.