DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment parvin and PARVG

DIOPT Version :9

Sequence 1:NP_001285464.1 Gene:parvin / 32990 FlyBaseID:FBgn0052528 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_011528604.1 Gene:PARVG / 64098 HGNCID:14654 Length:398 Species:Homo sapiens


Alignment Length:343 Identity:133/343 - (38%)
Similarity:197/343 - (57%) Gaps:20/343 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 WDKFSTLGRKRGTREVKKVQEEGKYAIDSPGSPSQYDI--------PPEDYALREHEQRAVIDPQ 82
            ||           .:.|:..|....|.::......||:        ||.:..|.:..::..:.|.
Human    50 WD-----------HKEKRAAESQLQAWEAMEPEFLYDLLQLPKGVEPPAEEELSKGGKKKYLPPT 103

  Fly    83 SISDPQVIKLQRILVDWINDELAEQRIIVQHLEEDMYDGQVLHKLWEKLTGKKLDVPEVTQSEQG 147
            |..||:..:||::|::|||..|..:.|:|:.|||||:||.:||.|:::|...||:..::..:...
Human   104 SRKDPKFEELQKVLMEWINATLLPEHIVVRSLEEDMFDGLILHHLFQRLAALKLEAEDIALTATS 168

  Fly   148 QHEKLNIVLKAVNHTLGFHQKIPKWSVASVHSKNIVAILHLLVALVRHFRAPVRLPENVFVTVVI 212
            |..||.:||:|||.:|...:...||||.|:.:|::::.|||||||.:.|:..:.||.||.|.|:.
Human   169 QKHKLTVVLEAVNRSLQLEEWQAKWSVESIFNKDLLSTLHLLVALAKRFQPDLSLPTNVQVEVIT 233

  Fly   213 AEKNAGVLNAQKFQEQITSEYDDLGMRCEKDAFDTLIDCAPDKLAVVKKSLITFVNKHLAKLNFE 277
            .|.....|.::|..||:| ||........||.||.|...||:|:..||::::.|||:.|.:|...
Human   234 IESTKSGLKSEKLVEQLT-EYSTDKDEPPKDVFDELFKLAPEKVNAVKEAIVNFVNQKLDRLGLS 297

  Fly   278 ISDLNTDFRDGVYLCLLMGLLGGFFVPLHEFHLTPQDVDQMVSNVAFAFDLMQDVGLPKPKARPE 342
            :.:|:|.|.|||.|.||:|.|.|||:.|.||:|||....:|:.||..|.:|::|.||......||
Human   298 VQNLDTQFADGVILLLLIGQLEGFFLHLKEFYLTPNSPAEMLHNVTLALELLKDEGLLSCPVSPE 362

  Fly   343 DIVNMDLKSTLRVLYSLF 360
            ||||.|.||||||||.||
Human   363 DIVNKDAKSTLRVLYGLF 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
parvinNP_001285464.1 CH 92..192 CDD:278723 42/99 (42%)
CH 258..359 CDD:278723 50/100 (50%)
PARVGXP_011528604.1 CH 112..213 CDD:278723 42/100 (42%)
CH 279..379 CDD:278723 50/99 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145373
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52959
OrthoDB 1 1.010 - - D373611at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12114
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.