DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment parvin and actn1

DIOPT Version :9

Sequence 1:NP_001285464.1 Gene:parvin / 32990 FlyBaseID:FBgn0052528 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_005157053.1 Gene:actn1 / 560400 ZFINID:ZDB-GENE-081113-4 Length:924 Species:Danio rerio


Alignment Length:320 Identity:69/320 - (21%)
Similarity:114/320 - (35%) Gaps:90/320 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 QYDIPPEDYALREHEQRAVIDPQSISDPQVIKLQR-ILVDWINDELAEQRIIVQHLEEDMYDGQV 123
            |||....||..:|.:.    |...:.||...|.|| ....|.|..|.:....::::|||..||..
Zfish    14 QYDGGENDYMQQEDDW----DRDMLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLK 74

  Fly   124 LHKLWEKLTGKKLDVPEVTQSEQGQHEKLNIVLKAVNHTLGF----HQKIPKWSVASVHSKNIVA 184
            |..|.|.::|::|..||  :.:...|:..|     ||..|||    ..|:.......:...|...
Zfish    75 LMLLLEVISGERLAKPE--RGKMRVHKISN-----VNKALGFIASKGVKLVSIGAEEIVDGNAKM 132

  Fly   185 ILHLLVALVRHFRAPVRLPENVFVTVVIAEKNAGVLNAQKFQEQITSEYDDLGMRCEKDAFDTLI 249
            .|.::..::..|.                        .|....:.||..:.|.:.|::..     
Zfish   133 TLGMIWTIILRFA------------------------IQDISVEETSAKEGLLLWCQRKT----- 168

  Fly   250 DCAPDKLAVVKKSLITFVNKHLAKLNFEISDLNTDFRDGVYLCLLMGLLGGFFVPLHEFHLTPQD 314
              ||.|                   |..|.:.:..::||:..|.|          :|...  |:.
Zfish   169 --APYK-------------------NVNIQNFHISWKDGLGFCAL----------IHRHR--PEL 200

  Fly   315 V-------DQMVSNVAFAFDLMQD-VGLPKPKARPEDIVNM---DLKSTLRVLYSLFTMF 363
            :       |..::|:..|||:.:. :.:|| ....||||..   |.|:.:..:.|.:..|
Zfish   201 IDYNKLRKDDPMTNLNTAFDVAEKYLDIPK-MLDAEDIVGTARPDEKAIMTYVSSFYHAF 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
parvinNP_001285464.1 CH 92..192 CDD:278723 27/104 (26%)
CH 258..359 CDD:278723 21/111 (19%)
actn1XP_005157053.1 CH 42..140 CDD:278723 27/104 (26%)
CH 155..259 CDD:237981 28/142 (20%)
Spectrin 284..394 CDD:278843
SPEC 405..632 CDD:238103
Spectrin 640..743 CDD:278843
EFh 760..849 CDD:238008
EF-hand_7 762..848 CDD:290234
EFhand_Ca_insen 854..920 CDD:285885
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.