DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment parvin and Rpp20

DIOPT Version :9

Sequence 1:NP_001285464.1 Gene:parvin / 32990 FlyBaseID:FBgn0052528 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001027078.1 Gene:Rpp20 / 3772007 FlyBaseID:FBgn0066304 Length:167 Species:Drosophila melanogaster


Alignment Length:105 Identity:23/105 - (21%)
Similarity:38/105 - (36%) Gaps:19/105 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 QYDIPPEDYALREHEQRAVIDPQSISDPQVIKLQRILVDWINDELAEQRIIVQHLEEDMYDGQVL 124
            ::...|......:.:...|:..|. ..|.|.....|.:....|..|:||    ..||.:..|  .
  Fly     8 EHGTKPRSAKYHKQQNHRVVRKQP-PRPAVSDRHNIYITSKTDFKAQQR----RCEELINSG--A 65

  Fly   125 HKLWEKLTGKKLDVPEVTQSEQGQHEKLNIVLKAVNHTLG 164
            |:::....|.     .||:.       |||.|:.|.::.|
  Fly    66 HEIFLHCMGF-----SVTRG-------LNIALRLVQNSDG 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
parvinNP_001285464.1 CH 92..192 CDD:278723 18/73 (25%)
CH 258..359 CDD:278723
Rpp20NP_001027078.1 Rpp20 39..132 CDD:289126 18/73 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3631
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.