DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment parvin and Actn3

DIOPT Version :9

Sequence 1:	NP_001285464.1	Gene:	parvin / 32990	FlyBaseID:	FBgn0052528	Length:	367	Species:	Drosophila melanogaster
Sequence 2:	NP_038484.1	Gene:	Actn3 / 11474	MGIID:	99678	Length:	900	Species:	Mus musculus

Alignment Length:	123	Identity:	35/123 - (28%)
Similarity:	62/123 - (50%)	Gaps:	15/123 - (12%)

- Green bases have known domain annotations that are detailed below.

  Fly   246 DTLIDCAPDKLAVVKKSLITFVNKHLAKLNFEISDLNTDFRDGVYLCLLMGLLGGFFVPLHE--- 307
            |.|:|.|.:|..  :|:...:.|.||.|...:|.::..|||:|:.|.||:.::.|..:|..:
Mouse    35 DLLLDPAWEKQQ--RKTFTAWCNSHLRKAGTQIENIEEDFRNGLKLMLLLEVISGERLPRPDKGK 97

  Fly   308 --FHLTPQDVDQMVSNVAFAFDLMQDVGLPKPKARPEDIVNMDLKSTLRVLYSLFTMF 363
              ||        .::||..|.|.:...|:.......|:||:.:||.||.:::::...|
Mouse    98 MRFH--------KIANVNKALDFIASKGVKLVSIGAEEIVDGNLKMTLGMIWTIILRF 147

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
parvin	NP_001285464.1	CH	92..192	CDD:278723
parvin	NP_001285464.1	CH	258..359	CDD:278723	29/105 (28%)
Actn3	NP_038484.1	Actin-binding	1..260		35/123 (28%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..26
		SAC6	42..>305	CDD:227401	31/116 (27%)
		Spectrin 1	287..397
		Spectrin	287..396	CDD:334073
		Spectrin 2	407..512
		SPEC	408..635	CDD:238103
		Spectrin 3	522..633
		SPEC	526..746	CDD:238103
		Spectrin 4	643..746
		PTZ00184	753..>857	CDD:185504
		EFhand_Ca_insen	830..896	CDD:312305
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910