DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment parvin and parvg

DIOPT Version :9

Sequence 1:NP_001285464.1 Gene:parvin / 32990 FlyBaseID:FBgn0052528 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_002942486.3 Gene:parvg / 100488743 XenbaseID:XB-GENE-996662 Length:314 Species:Xenopus tropicalis


Alignment Length:310 Identity:122/310 - (39%)
Similarity:183/310 - (59%) Gaps:18/310 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 AIDSPGSPSQYDIPPEDYALREHEQRAVIDPQSISDPQVIKLQRILVDWINDELAEQRIIVQHLE 115
            ::|:||                 |.:..|...:.:||:...||..|:||||.||.|:.|:|:.:|
 Frog    17 SVDAPG-----------------EIKKFIQANAKNDPKFQDLQTFLIDWINAELKEEHIVVKSVE 64

  Fly   116 EDMYDGQVLHKLWEKLTGKKLDVPEVTQSEQGQHEKLNIVLKAVNHTLGFHQKIPKWSVASVHSK 180
            ||:|||.|||.|.:|:.|.||:|.|:..|...|..||.::::|:..:|...:...|||:..:|:|
 Frog    65 EDLYDGLVLHHLLKKIAGMKLEVEEIALSASSQKRKLGVIMEAITQSLQLQETDLKWSLNEIHNK 129

  Fly   181 NIVAILHLLVALVRHFRAPVRLPENVFVTVVIAEKNAGVLNAQKFQEQITSEYDDLGMRCEKDAF 245
            :::..|||:|||.:|||..:.||.||.|.|:..|.....:..:...|.||...|. ..:.:.|||
 Frog   130 DLLCTLHLIVALAQHFRPDLELPANVGVEVIRVEPTRNGMKTENVIEFITGSRDG-DAKSKPDAF 193

  Fly   246 DTLIDCAPDKLAVVKKSLITFVNKHLAKLNFEISDLNTDFRDGVYLCLLMGLLGGFFVPLHEFHL 310
            |.|.:.:|:|:..|||:::.|||||||.|:..::|..:.|.|||.|.||:|.|.|:|:.|..|.|
 Frog   194 DHLFEQSPEKVEDVKKAIVNFVNKHLANLSLTVTDPESQFADGVILLLLIGQLEGYFMNLGSFFL 258

  Fly   311 TPQDVDQMVSNVAFAFDLMQDVGLPKPKARPEDIVNMDLKSTLRVLYSLF 360
            ||...:..|.||:.|.:|:.:.|:.:....|.||||.|||:|||:||.||
 Frog   259 TPSTQEDKVHNVSLAMELLLEGGIIQNPMDPADIVNGDLKATLRLLYGLF 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
parvinNP_001285464.1 CH 92..192 CDD:278723 43/99 (43%)
CH 258..359 CDD:278723 47/100 (47%)
parvgXP_002942486.3 CH_PARVG_rpt1 40..145 CDD:409154 45/104 (43%)
CH_PARVG_rpt2 191..312 CDD:409156 56/118 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D373611at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.