DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment parvin and pop7

DIOPT Version :9

Sequence 1:NP_001285464.1 Gene:parvin / 32990 FlyBaseID:FBgn0052528 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001006004.1 Gene:pop7 / 100004610 ZFINID:ZDB-GENE-041010-88 Length:148 Species:Danio rerio


Alignment Length:36 Identity:13/36 - (36%)
Similarity:17/36 - (47%) Gaps:4/36 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   334 LPK--PKARPEDIVNM--DLKSTLRVLYSLFTMFRD 365
            ||:  ||.|.:..|||  |.|:.|.....|....|:
Zfish    40 LPRKLPKRRNDVYVNMKTDFKAQLARCQKLLDAHRE 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
parvinNP_001285464.1 CH 92..192 CDD:278723
CH 258..359 CDD:278723 11/28 (39%)
pop7NP_001006004.1 Rpp20 46..142 CDD:289126 10/30 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.