powered by:
Protein Alignment COX6B and COX12
DIOPT Version :9
Sequence 1: | NP_728294.1 |
Gene: | COX6B / 32989 |
FlyBaseID: | FBgn0031066 |
Length: | 96 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_013139.1 |
Gene: | COX12 / 850727 |
SGDID: | S000004028 |
Length: | 83 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 72 |
Identity: | 42/72 - (58%) |
Similarity: | 52/72 - (72%) |
Gaps: | 0/72 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 25 LETAPFDPRFPNQNVTRYCYQSYIDFHRCQKKRGEDFAPCNYFQKVYKSMCPNAWVEKWDDQRES 89
|.|..||.|||.||.|::|:|||:|:|:|...:|||||||..|.|.|.::||..|:||||||||.
Yeast 9 LHTVGFDARFPQQNQTKHCWQSYVDYHKCVNMKGEDFAPCKVFWKTYNALCPLDWIEKWDDQREK 73
Fly 90 GTFPGRI 96
|.|.|.|
Yeast 74 GIFAGDI 80
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C157345376 |
Domainoid |
1 |
1.000 |
94 |
1.000 |
Domainoid score |
I1682 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3057 |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
1 |
1.000 |
- |
- |
|
H39658 |
Inparanoid |
1 |
1.050 |
106 |
1.000 |
Inparanoid score |
I1411 |
Isobase |
1 |
0.950 |
- |
0 |
Normalized mean entropy |
S605 |
OMA |
1 |
1.010 |
- |
- |
|
QHG55215 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0001829 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
oto99954 |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_102345 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R2074 |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X1355 |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
15 | 14.640 |
|
Return to query results.
Submit another query.