DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX6B and COX12

DIOPT Version :9

Sequence 1:NP_728294.1 Gene:COX6B / 32989 FlyBaseID:FBgn0031066 Length:96 Species:Drosophila melanogaster
Sequence 2:NP_013139.1 Gene:COX12 / 850727 SGDID:S000004028 Length:83 Species:Saccharomyces cerevisiae


Alignment Length:72 Identity:42/72 - (58%)
Similarity:52/72 - (72%) Gaps:0/72 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LETAPFDPRFPNQNVTRYCYQSYIDFHRCQKKRGEDFAPCNYFQKVYKSMCPNAWVEKWDDQRES 89
            |.|..||.|||.||.|::|:|||:|:|:|...:|||||||..|.|.|.::||..|:||||||||.
Yeast     9 LHTVGFDARFPQQNQTKHCWQSYVDYHKCVNMKGEDFAPCKVFWKTYNALCPLDWIEKWDDQREK 73

  Fly    90 GTFPGRI 96
            |.|.|.|
Yeast    74 GIFAGDI 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX6BNP_728294.1 Cyt_c_Oxidase_VIb 22..95 CDD:238466 40/69 (58%)
COX12NP_013139.1 Cyt_c_Oxidase_VIb 5..79 CDD:238466 40/69 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345376
Domainoid 1 1.000 94 1.000 Domainoid score I1682
eggNOG 1 0.900 - - E1_KOG3057
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H39658
Inparanoid 1 1.050 106 1.000 Inparanoid score I1411
Isobase 1 0.950 - 0 Normalized mean entropy S605
OMA 1 1.010 - - QHG55215
OrthoFinder 1 1.000 - - FOG0001829
OrthoInspector 1 1.000 - - oto99954
orthoMCL 1 0.900 - - OOG6_102345
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2074
SonicParanoid 1 1.000 - - X1355
TreeFam 1 0.960 - -
1514.640

Return to query results.
Submit another query.