DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX6B and AT1G32710

DIOPT Version :9

Sequence 1:NP_728294.1 Gene:COX6B / 32989 FlyBaseID:FBgn0031066 Length:96 Species:Drosophila melanogaster
Sequence 2:NP_174548.1 Gene:AT1G32710 / 840165 AraportID:AT1G32710 Length:134 Species:Arabidopsis thaliana


Alignment Length:81 Identity:25/81 - (30%)
Similarity:39/81 - (48%) Gaps:12/81 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FMSKNKSSDKSSDSSNMSAYKLETAPFDPRFPNQNVTRYCYQSYIDFHRCQKKRGEDFAPCNYFQ 68
            |.:|...|.:.:|           |..:.|||..|.||:|:..::.:|:|.:|.|.|...||..:
plant    46 FRAKRGDSGRETD-----------AAVEERFPVTNETRHCFNRFMQYHKCIEKNGRDANDCNNLR 99

  Fly    69 KVYKSMCPNAWVEK-W 83
            ...:|:||...|.| |
plant   100 DYVRSICPEELVSKIW 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX6BNP_728294.1 Cyt_c_Oxidase_VIb 22..95 CDD:238466 21/63 (33%)
AT1G32710NP_174548.1 Cyt_c_Oxidase_VIb 52..126 CDD:238466 23/75 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3057
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1586678at2759
OrthoFinder 1 1.000 - - FOG0001829
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.