DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX6B and AT4G28060

DIOPT Version :9

Sequence 1:NP_728294.1 Gene:COX6B / 32989 FlyBaseID:FBgn0031066 Length:96 Species:Drosophila melanogaster
Sequence 2:NP_194535.2 Gene:AT4G28060 / 828921 AraportID:AT4G28060 Length:78 Species:Arabidopsis thaliana


Alignment Length:71 Identity:39/71 - (54%)
Similarity:52/71 - (73%) Gaps:0/71 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KLETAPFDPRFPNQNVTRYCYQSYIDFHRCQKKRGEDFAPCNYFQKVYKSMCPNAWVEKWDDQRE 88
            :|:|||.|.|||..|.||:|:..||:||||...:|||...|..|.|.|:::||..||:||::|||
plant     6 ELKTAPADFRFPTTNQTRHCFTRYIEFHRCTTAKGEDANECERFAKYYRALCPGEWVDKWNEQRE 70

  Fly    89 SGTFPG 94
            :|||||
plant    71 TGTFPG 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX6BNP_728294.1 Cyt_c_Oxidase_VIb 22..95 CDD:238466 39/71 (55%)
AT4G28060NP_194535.2 Cyt_c_Oxidase_VIb 3..77 CDD:238466 39/71 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 82 1.000 Domainoid score I2912
eggNOG 1 0.900 - - E1_KOG3057
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 98 1.000 Inparanoid score I2200
OMA 1 1.010 - - QHG55215
OrthoDB 1 1.010 - - D1586678at2759
OrthoFinder 1 1.000 - - FOG0001829
OrthoInspector 1 1.000 - - otm2850
orthoMCL 1 0.900 - - OOG6_102345
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1355
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.740

Return to query results.
Submit another query.