DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX6B and Cox6b1

DIOPT Version :10

Sequence 1:NP_728294.1 Gene:COX6B / 32989 FlyBaseID:FBgn0031066 Length:96 Species:Drosophila melanogaster
Sequence 2:NP_001138745.1 Gene:Cox6b1 / 688869 RGDID:1584097 Length:86 Species:Rattus norvegicus


Alignment Length:77 Identity:43/77 - (55%)
Similarity:58/77 - (75%) Gaps:5/77 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 YKLETAPFDPRFPNQNVTRYCYQSYIDFHRCQK---KRGEDFAPCNYFQKVYKSMCPNAWVEKWD 84
            ||  |||||.||||||.|:.|:|:|:|||||:|   .:|.|.:.|.::::||||:||.:||..||
  Rat    12 YK--TAPFDSRFPNQNQTKNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPVSWVSAWD 74

  Fly    85 DQRESGTFPGRI 96
            |:...|||||:|
  Rat    75 DRIAEGTFPGKI 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX6BNP_728294.1 Cyt_c_Oxidase_VIb 22..95 CDD:238466 41/74 (55%)
Cox6b1NP_001138745.1 Cyt_c_Oxidase_VIb 8..85 CDD:238466 41/74 (55%)

Return to query results.
Submit another query.