DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX6B and Coa6

DIOPT Version :9

Sequence 1:NP_728294.1 Gene:COX6B / 32989 FlyBaseID:FBgn0031066 Length:96 Species:Drosophila melanogaster
Sequence 2:NP_778152.1 Gene:Coa6 / 67892 MGIID:1915142 Length:79 Species:Mus musculus


Alignment Length:54 Identity:13/54 - (24%)
Similarity:27/54 - (50%) Gaps:0/54 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PNQNVTRYCYQSYIDFHRCQKKRGEDFAPCNYFQKVYKSMCPNAWVEKWDDQRE 88
            |:....:.|:.:...:.||.....||.|.|...:..:::.||..|::.:|.:|:
Mouse     4 PSMKERQACWGARDLYWRCLDDNAEDAARCQKLRSSFEASCPQQWIKYFDKRRD 57

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX6BNP_728294.1 Cyt_c_Oxidase_VIb 22..95 CDD:238466 13/54 (24%)
Coa6NP_778152.1 Cyt_c_Oxidase_VIb 4..64 CDD:238466 13/54 (24%)
Cx9C motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01150 12..22 1/9 (11%)
Cx10C motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01150 33..44 1/10 (10%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3057
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.