Sequence 1: | NP_728294.1 | Gene: | COX6B / 32989 | FlyBaseID: | FBgn0031066 | Length: | 96 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001034174.1 | Gene: | Cox6b2 / 654441 | RGDID: | 1591896 | Length: | 88 | Species: | Rattus norvegicus |
Alignment Length: | 73 | Identity: | 39/73 - (53%) |
---|---|---|---|
Similarity: | 58/73 - (79%) | Gaps: | 3/73 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 27 TAPFDPRFPNQNVTRYCYQSYIDFHRCQK---KRGEDFAPCNYFQKVYKSMCPNAWVEKWDDQRE 88
Fly 89 SGTFPGRI 96 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
COX6B | NP_728294.1 | Cyt_c_Oxidase_VIb | 22..95 | CDD:238466 | 37/70 (53%) |
Cox6b2 | NP_001034174.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..21 | 3/4 (75%) | |
Cyt_c_Oxidase_VIb | 15..87 | CDD:238466 | 37/70 (53%) | ||
Cx9C motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01150 | 32..42 | 5/9 (56%) | |||
Cx10C motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01150 | 56..67 | 4/10 (40%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C166349415 | |
Domainoid | 1 | 1.000 | 81 | 1.000 | Domainoid score | I8295 |
eggNOG | 1 | 0.900 | - | - | E1_KOG3057 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 101 | 1.000 | Inparanoid score | I4884 |
OMA | 1 | 1.010 | - | - | QHG55215 | |
OrthoDB | 1 | 1.010 | - | - | D1586678at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0001829 | |
OrthoInspector | 1 | 1.000 | - | - | otm45889 | |
orthoMCL | 1 | 0.900 | - | - | OOG6_102345 | |
Panther | 1 | 1.100 | - | - | O | PTHR11387 |
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 1 | 1.000 | - | - | X1355 | |
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 1 | 0.960 | - | - | ||
14 | 13.770 |