DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX6B and Cox6b2

DIOPT Version :9

Sequence 1:NP_728294.1 Gene:COX6B / 32989 FlyBaseID:FBgn0031066 Length:96 Species:Drosophila melanogaster
Sequence 2:NP_001034174.1 Gene:Cox6b2 / 654441 RGDID:1591896 Length:88 Species:Rattus norvegicus


Alignment Length:73 Identity:39/73 - (53%)
Similarity:58/73 - (79%) Gaps:3/73 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 TAPFDPRFPNQNVTRYCYQSYIDFHRCQK---KRGEDFAPCNYFQKVYKSMCPNAWVEKWDDQRE 88
            |.||||||||||.||.|||:::|:|||.|   :||::...|:|:.:|:.|:||.:||::|::|.:
  Rat    16 TPPFDPRFPNQNQTRNCYQNFLDYHRCVKTMDRRGKNTQACDYYFRVFHSLCPVSWVQRWNEQIK 80

  Fly    89 SGTFPGRI 96
            .|||||:|
  Rat    81 QGTFPGKI 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX6BNP_728294.1 Cyt_c_Oxidase_VIb 22..95 CDD:238466 37/70 (53%)
Cox6b2NP_001034174.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21 3/4 (75%)
Cyt_c_Oxidase_VIb 15..87 CDD:238466 37/70 (53%)
Cx9C motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01150 32..42 5/9 (56%)
Cx10C motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01150 56..67 4/10 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349415
Domainoid 1 1.000 81 1.000 Domainoid score I8295
eggNOG 1 0.900 - - E1_KOG3057
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 101 1.000 Inparanoid score I4884
OMA 1 1.010 - - QHG55215
OrthoDB 1 1.010 - - D1586678at2759
OrthoFinder 1 1.000 - - FOG0001829
OrthoInspector 1 1.000 - - otm45889
orthoMCL 1 0.900 - - OOG6_102345
Panther 1 1.100 - - O PTHR11387
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1355
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.770

Return to query results.
Submit another query.