DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX6B and cox6b1

DIOPT Version :10

Sequence 1:NP_728294.1 Gene:COX6B / 32989 FlyBaseID:FBgn0031066 Length:96 Species:Drosophila melanogaster
Sequence 2:NP_001002695.1 Gene:cox6b1 / 436968 ZFINID:ZDB-GENE-040718-448 Length:86 Species:Danio rerio


Alignment Length:79 Identity:49/79 - (62%)
Similarity:63/79 - (79%) Gaps:6/79 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KLE---TAPFDPRFPNQNVTRYCYQSYIDFHRCQK---KRGEDFAPCNYFQKVYKSMCPNAWVEK 82
            |||   |||||.||||||.||.|:|:|:|:|||||   .:|.|.|||:::::||||:||.:|:||
Zfish     8 KLENYRTAPFDARFPNQNQTRNCWQNYLDYHRCQKALDAKGVDTAPCDWYKRVYKSLCPLSWIEK 72

  Fly    83 WDDQRESGTFPGRI 96
            ||.|||.|.|||:|
Zfish    73 WDTQREEGNFPGKI 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX6BNP_728294.1 Cyt_c_Oxidase_VIb 22..95 CDD:238466 47/76 (62%)
cox6b1NP_001002695.1 Cyt_c_Oxidase_VIb 8..85 CDD:238466 47/76 (62%)

Return to query results.
Submit another query.