DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX6B and cox6b2

DIOPT Version :9

Sequence 1:NP_728294.1 Gene:COX6B / 32989 FlyBaseID:FBgn0031066 Length:96 Species:Drosophila melanogaster
Sequence 2:NP_001269021.1 Gene:cox6b2 / 393478 ZFINID:ZDB-GENE-040426-1566 Length:86 Species:Danio rerio


Alignment Length:73 Identity:45/73 - (61%)
Similarity:57/73 - (78%) Gaps:3/73 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 TAPFDPRFPNQNVTRYCYQSYIDFHRCQK---KRGEDFAPCNYFQKVYKSMCPNAWVEKWDDQRE 88
            |||||.||||.|.||.|||:|:|||||.|   .:|:|.:||.::|:||||:||.:||.|||.|.|
Zfish    14 TAPFDARFPNTNQTRNCYQNYLDFHRCNKALSSKGQDTSPCEWYQRVYKSLCPISWVGKWDSQIE 78

  Fly    89 SGTFPGRI 96
            .|:|||:|
Zfish    79 DGSFPGKI 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX6BNP_728294.1 Cyt_c_Oxidase_VIb 22..95 CDD:238466 43/70 (61%)
cox6b2NP_001269021.1 Cyt_c_Oxidase_VIb 8..85 CDD:238466 43/70 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580245
Domainoid 1 1.000 91 1.000 Domainoid score I7677
eggNOG 1 0.900 - - E1_KOG3057
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4828
OMA 1 1.010 - - QHG55215
OrthoDB 1 1.010 - - D1586678at2759
OrthoFinder 1 1.000 - - FOG0001829
OrthoInspector 1 1.000 - - otm26105
orthoMCL 1 0.900 - - OOG6_102345
Panther 1 1.100 - - O PTHR11387
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2074
SonicParanoid 1 1.000 - - X1355
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.