DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX6B and cox-6B

DIOPT Version :10

Sequence 1:NP_728294.1 Gene:COX6B / 32989 FlyBaseID:FBgn0031066 Length:96 Species:Drosophila melanogaster
Sequence 2:NP_497618.1 Gene:cox-6B / 3565081 WormBaseID:WBGene00022170 Length:121 Species:Caenorhabditis elegans


Alignment Length:100 Identity:40/100 - (40%)
Similarity:51/100 - (51%) Gaps:11/100 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KNKSSDKSSDSSNMSAYKLET-----------APFDPRFPNQNVTRYCYQSYIDFHRCQKKRGED 60
            |.|.||......:...||.||           ||:|.|||.....|.|:..|:|||||.:..|:|
 Worm    19 KEKFSDALRHPDSPDWYKKETHESVKKDLLWAAPYDARFPQVRKQRQCFAYYVDFHRCNELMGQD 83

  Fly    61 FAPCNYFQKVYKSMCPNAWVEKWDDQRESGTFPGR 95
            :.||.:||.|||..||..|.|:||:....|.||.:
 Worm    84 YKPCKFFQNVYKDFCPGFWTERWDELLSEGRFPAK 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX6BNP_728294.1 Cyt_c_Oxidase_VIb 22..95 CDD:238466 36/83 (43%)
cox-6BNP_497618.1 Cyt_c_Oxidase_VIb 44..118 CDD:238466 32/73 (44%)

Return to query results.
Submit another query.