DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX6B and COX6B2

DIOPT Version :9

Sequence 1:NP_728294.1 Gene:COX6B / 32989 FlyBaseID:FBgn0031066 Length:96 Species:Drosophila melanogaster
Sequence 2:NP_001356727.1 Gene:COX6B2 / 125965 HGNCID:24380 Length:88 Species:Homo sapiens


Alignment Length:76 Identity:39/76 - (51%)
Similarity:55/76 - (72%) Gaps:3/76 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KLETAPFDPRFPNQNVTRYCYQSYIDFHRCQK---KRGEDFAPCNYFQKVYKSMCPNAWVEKWDD 85
            |..|.|||||||:||..|.|||:::|:|||.|   :||:...||.|:.:||.|:||.:|||.|::
Human    13 KWSTPPFDPRFPSQNQIRNCYQNFLDYHRCLKTRTRRGKSTQPCEYYFRVYHSLCPISWVESWNE 77

  Fly    86 QRESGTFPGRI 96
            |.::|.|.|:|
Human    78 QIKNGIFAGKI 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX6BNP_728294.1 Cyt_c_Oxidase_VIb 22..95 CDD:238466 37/73 (51%)
COX6B2NP_001356727.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22 5/8 (63%)
Cyt_c_Oxidase_VIb 10..87 CDD:238466 37/73 (51%)
Cx9C motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01150 32..42 5/9 (56%)
Cx10C motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01150 56..67 5/10 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155529
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3057
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55215
OrthoDB 1 1.010 - - D1586678at2759
OrthoFinder 1 1.000 - - FOG0001829
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102345
Panther 1 1.100 - - O PTHR11387
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2074
SonicParanoid 1 1.000 - - X1355
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.790

Return to query results.
Submit another query.