DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14234 and Tmem198b

DIOPT Version :9

Sequence 1:NP_001356951.1 Gene:CG14234 / 32988 FlyBaseID:FBgn0031065 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_001102751.1 Gene:Tmem198b / 500762 RGDID:1562342 Length:345 Species:Rattus norvegicus


Alignment Length:276 Identity:85/276 - (30%)
Similarity:125/276 - (45%) Gaps:56/276 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 ILEGQTCTPTAPEPLAAILWAIFAVFGIVYALLGYRCLRAVGFLSGLLVGANGIFIL---QDFQI 92
            |||.|.....||    |::.|:...|||:|..|||||.:||.||||||.||..||:|   :....
  Rat    30 ILEPQDSLALAP----ALVCALCCCFGIIYCCLGYRCFKAVMFLSGLLSGALVIFLLCHKERVLE 90

  Fly    93 TFLGKPADSALAIVAGLLGAVLGSTYPVASVLISAFAGALLSGAAMAVCVATFPDNEFGYR--EI 155
            |.|.....:.:|:..|||..::  |..|.||  ..|...||.|..:.  ..|....|..||  ..
  Rat    91 TQLSLEVSAGIALGIGLLCGLV--TMLVRSV--GLFLTGLLLGLTLG--AGTLLGTEPIYRPHSA 149

  Fly   156 YVAV---VGGAVICSVLTLCCVKYVTILTSSIVGTAMILSAIDFFTHGLETINWIIGMR----PH 213
            :|.|   :|.|::.::|||...:..|:|.::::|.|::::..|:|..|| .:...:|.|    |.
  Rat   150 WVPVGGLIGLALLGALLTLRWPRPFTVLGTALLGAAVLVACADYFLEGL-ALGTRLGKRLQALPE 213

  Fly   214 PSPPPC-YGGLLIAAWPVTIVLSIMVQCFITAWRVDHRKRVYMRHHNHPGHAHGAH----LPHSQ 273
             .||.| |..:|:..||:...|..:.|     |::...:|             |:|    |.|.|
  Rat   214 -LPPLCWYSWVLLGTWPILGALGTLAQ-----WKLMAEER-------------GSHTNVILSHQQ 259

  Fly   274 ---------QQAGPNH 280
                     ||....|
  Rat   260 RHLQLLRLHQQESKRH 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14234NP_001356951.1 DUF4203 55..240 CDD:338988 66/197 (34%)
SelP_N <249..288 CDD:335846 9/45 (20%)
Tmem198bNP_001102751.1 DUF4203 43..240 CDD:404726 68/209 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340529
Domainoid 1 1.000 92 1.000 Domainoid score I7425
eggNOG 1 0.900 - - E1_28JN9
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 101 1.000 Inparanoid score I4883
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509246at2759
OrthoFinder 1 1.000 - - FOG0003355
OrthoInspector 1 1.000 - - otm45625
orthoMCL 1 0.900 - - OOG6_105348
Panther 1 1.100 - - O PTHR31247
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.760

Return to query results.
Submit another query.