DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14234 and TMEM198

DIOPT Version :9

Sequence 1:NP_001356951.1 Gene:CG14234 / 32988 FlyBaseID:FBgn0031065 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_001005209.1 Gene:TMEM198 / 130612 HGNCID:33704 Length:360 Species:Homo sapiens


Alignment Length:317 Identity:82/317 - (25%)
Similarity:145/317 - (45%) Gaps:57/317 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 EPLAAILWAIFAVFGIVYALLGYRCLRAVGFLSGLLVGANGIFIL---QDFQITFLGKPADSALA 104
            :.|.|::..:..:||:||...||||.:||.||:|||.|:..||:|   :....|.|...|.:.:|
Human    35 QALPALVCIMCCLFGVVYCFFGYRCFKAVLFLTGLLFGSVVIFLLCYRERVLETQLSAGASAGIA 99

  Fly   105 IVAGLL-GAVLGSTYPVASVLISAFAGALLSGAAMAVCVATF-PDNEFGYREIYVAVVGGAVICS 167
            :..||| |.|......|...|:....|.||:.||:......: |.:.:|...:   ::||.::|:
Human   100 LGIGLLCGLVAMLVRSVGLFLVGLLLGLLLAAAALLGSAPYYQPGSVWGPLGL---LLGGGLLCA 161

  Fly   168 VLTLCCVKYVTILTSSIVGTAMILSAIDFFTHGLETINWII-GMRPHPSPPPCY-GGLLIAAWPV 230
            :|||...:.:|.|.:::.|.|:|.:|.|:|...|....::: .:|..|.||.|: ...|:|.||:
Human   162 LLTLRWPRPLTTLATAVTGAALIATAADYFAELLLLGRYVVERLRAAPVPPLCWRSWALLALWPL 226

  Fly   231 TIVLSIMVQCFITAWRVDHRKRVYMRHHNHPGHAHGAHLPHSQQQAGPNHGIAPVRRSQSRTRET 295
            ..::.::||..:||....|.:.|..|....                        |:..:.|.:|.
Human   227 LSLMGVLVQWRVTAEGDSHTEVVISRQRRR------------------------VQLMRIRQQED 267

  Fly   296 REEARQRK-----------------------FRYLYQVRTARGDIISQNFVSALQKR 329
            |:|.|::|                       .|....::...||::|.:::.:.:.|
Human   268 RKEKRRKKRPPRAPLRGPRAPPRPGPPDPAYRRRPVPIKRFNGDVLSPSYIQSFRDR 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14234NP_001356951.1 DUF4203 55..240 CDD:338988 62/191 (32%)
SelP_N <249..288 CDD:335846 4/38 (11%)
TMEM198NP_001005209.1 DUF4203 41..204 CDD:290597 52/165 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..304 7/43 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 324..360 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146876
Domainoid 1 1.000 92 1.000 Domainoid score I7658
eggNOG 1 0.900 - - E1_28JN9
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I5009
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45665
OrthoDB 1 1.010 - - D1509246at2759
OrthoFinder 1 1.000 - - FOG0003355
OrthoInspector 1 1.000 - - oto90302
orthoMCL 1 0.900 - - OOG6_105348
Panther 1 1.100 - - LDO PTHR31247
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6324
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.