DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14232 and Tmed8

DIOPT Version :9

Sequence 1:NP_001245766.1 Gene:CG14232 / 32983 FlyBaseID:FBgn0031061 Length:480 Species:Drosophila melanogaster
Sequence 2:XP_036013407.1 Gene:Tmed8 / 382620 MGIID:1923480 Length:363 Species:Mus musculus


Alignment Length:416 Identity:92/416 - (22%)
Similarity:154/416 - (37%) Gaps:135/416 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SGTSSSETAQSTDMAPSSAEKWGFPLIELYRLAFTFYKRNSGKAIHLSYEDNLKLIAFKQQAALG 70
            |...||....|......:|.:|              .:..|.:.:.:|          .:|||.|
Mouse    64 SARLSSAALASPSAVSGAASRW--------------LRSRSRRGLQMS----------DRQAAEG 104

  Fly    71 PFNTSRAPALGVLDVIGRDRQQHWQLLGEITREQAMEGFVDLLDTMCSA---------FRP-YIE 125
            |...|.|...|....:| ||:...:.....:.::.:|. .::...:.||         :|| .:.
Mouse   105 PAFWSPAARRGSAGGVG-DRRGVEESQAAASEKEDLES-TNVSSPLASASDPAAESSPYRPQMVS 167

  Fly   126 AVRQDRDETLRKELRLMEEKKEARERQENAQQELLEEGYKEELQRRQLQDALNKQTYQQFKLYAE 190
            ...:|..|.|       :....|.|.|...:|..|..|..:.|..                 .|:
Mouse   168 PASKDTTEDL-------QNVAGASEGQAPGEQAALPAGQTQVLSE-----------------MAK 208

  Fly   191 KQFPGNPEQQAVLIHQLQREHYHQYMQQLHLQNQNQNQNQNTEDKGHQEAEHVPGNNNNSSTDLP 255
            .|.|..||...:    :|.||                                .|..:..|.||.
Mouse   209 YQAPQRPEDTVM----IQSEH--------------------------------TGAIDVLSADLE 237

  Fly   256 NAMEGLKLGEVETQQHQQLAEQQDGHVEQTLEGVGQEQHGEEEYDDYVMICPAKIWTRPDIEQFK 320
            :|.   .||:     |::::..                          ::.|..:||...:::||
Mouse   238 SAD---LLGD-----HRKVSPP--------------------------LMAPPCVWTFAKVKEFK 268

  Fly   321 TEVSAGDGDGVITIGHGDTVTVRVPTNMNGKCIFWEFATDSYDIGFGIYFEWAKPVTNEVTVHVS 385
            :::.. :.:..:.:..|:.||:||||:..||.:.||||||.||||||:||:|....:.::||.||
Mouse   269 SKLGK-EKNSRLVVKRGEVVTIRVPTHPEGKRVCWEFATDDYDIGFGVYFDWTPVTSTDITVQVS 332

  Fly   386 DSDEDEDCVDEDYLSTTEDLESGSLS 411
            ||.|||: .:||   ..|::|..:::
Mouse   333 DSSEDEE-EEED---EEEEIEGWAMA 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14232NP_001245766.1 ACBP 33..117 CDD:279259 14/83 (17%)
GOLD_2 334..478 CDD:290608 37/78 (47%)
Tmed8XP_036013407.1 GOLD_2 281..>331 CDD:404736 26/49 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841568
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3878
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D321733at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto93052
orthoMCL 1 0.900 - - OOG6_105136
Panther 1 1.100 - - O PTHR22973
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.