DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14232 and TMED8

DIOPT Version :9

Sequence 1:NP_001245766.1 Gene:CG14232 / 32983 FlyBaseID:FBgn0031061 Length:480 Species:Drosophila melanogaster
Sequence 2:NP_001333060.1 Gene:TMED8 / 283578 HGNCID:18633 Length:330 Species:Homo sapiens


Alignment Length:436 Identity:128/436 - (29%)
Similarity:185/436 - (42%) Gaps:135/436 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 QAALGPFN---TSR-APALGVLDVIGRDRQQ------------HWQLLGEITREQAMEGFVDLLD 114
            |||.||.:   |:| ..|.||.|..|.:..|            ...||...|..:.         
Human     5 QAAEGPGSWSPTARPGSAGGVGDCQGVEGSQAAASENEDLENKDTSLLASATDPEP--------- 60

  Fly   115 TMCSA-FRP-YIEAVRQDRDETLRKELRLMEEKKEARERQENAQQELLEEGYKEELQRRQLQDAL 177
              ||: .|| .:..|.:|..|.|||....:|            .|.|:    |::|........|
Human    61 --CSSPHRPQMVSPVSKDATEDLRKATGPLE------------AQALV----KQDLLPADQAQVL 107

  Fly   178 NKQTYQQFKLYAEKQFPGNPEQQAVLIHQLQREHYHQYMQQLHLQNQNQNQNQNTEDKGHQEAEH 242
            |:.:..|...|...|..|:       |..:|.||                               
Human   108 NESSVVQMAKYQVPQRSGD-------IVMIQSEH------------------------------- 134

  Fly   243 VPGNNNNSSTDLPNAMEGLKLGEVETQQHQQLAEQQDGHVEQTLEGVGQEQHGEEEYDDYVMICP 307
             .|..:..|.||.:|.   .||:     |::::..                          ::.|
Human   135 -TGAIDVLSADLESAD---LLGD-----HRKVSPP--------------------------LMAP 164

  Fly   308 AKIWTRPDIEQFKTEVSAGDGDGVITIGHGDTVTVRVPTNMNGKCIFWEFATDSYDIGFGIYFEW 372
            ..|||...:::||:::.. :.:..:.:..|:.||:||||:..||.:.||||||.||||||:||:|
Human   165 PCIWTFAKVKEFKSKLGK-EKNSRLVVKRGEVVTIRVPTHPEGKRVCWEFATDDYDIGFGVYFDW 228

  Fly   373 AKPVTNEVTVHVSDSDEDEDCVDEDYLSTTE-----DLESGSLSQERGAVNNPTAAPKAPISIIV 432
            ....:.::||.||||.:|||..:|:.....|     |:|.||.|..||....           ::
Human   229 TPVTSTDITVQVSDSSDDEDEEEEEEEEIEEPVPAGDVERGSRSSLRGRYGE-----------VM 282

  Fly   433 PIYRRECYNEVYVGSHSYPGEGVYLLKFDNSYSIWRNKTLYYRVYY 478
            |:|||:.:.:|..|||.|||||:||||||||||:.||||||:.:||
Human   283 PVYRRDSHRDVQAGSHDYPGEGIYLLKFDNSYSLLRNKTLYFHIYY 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14232NP_001245766.1 ACBP 33..117 CDD:279259 16/66 (24%)
GOLD_2 334..478 CDD:290608 71/148 (48%)
TMED8NP_001333060.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..78 22/83 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 237..272 15/34 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151433
Domainoid 1 1.000 163 1.000 Domainoid score I3969
eggNOG 1 0.900 - - E1_KOG3878
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D321733at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto89482
orthoMCL 1 0.900 - - OOG6_105136
Panther 1 1.100 - - O PTHR22973
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.750

Return to query results.
Submit another query.