DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14231 and KAE1

DIOPT Version :9

Sequence 1:NP_001245765.1 Gene:CG14231 / 32982 FlyBaseID:FBgn0031060 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_012964.2 Gene:KAE1 / 853910 SGDID:S000001746 Length:386 Species:Saccharomyces cerevisiae


Alignment Length:376 Identity:88/376 - (23%)
Similarity:144/376 - (38%) Gaps:82/376 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LGIETSCDDTGIAIV---------------DTTGRVIANVLESQQEFHTRYG-GIIPPRAQDLHR 76
            ||:|.|.:..|:.||               |....:::|:.::   :.|..| |.:|......||
Yeast    19 LGLEGSANKLGVGIVKHPLLPKHANSDLSYDCEAEMLSNIRDT---YVTPPGEGFLPRDTARHHR 80

  Fly    77 ARIESAYQRCMEAAQLKPDQL--TAIAVTTRPGLPLSLLVGVRFARHLARRLQKPLLPVHHMEAH 139
            .......::.:..|.:|...|  ..|..|..||:...|...|..||..:.....||:.|:|...|
Yeast    81 NWCIRLIKQALAEADIKSPTLDIDVICFTKGPGMGAPLHSVVIAARTCSLLWDVPLVGVNHCIGH 145

  Fly   140 ALQAR----MEHPEQIGYPFLCLLASGGHCQLVVANGPGRLTLLGQTLDDAPGEAFDKIGRRLRL 200
            ....|    .::|       :.|..|||:.| |:|....|..:.|:|||.|.|...|:..|.|::
Yeast   146 IEMGREITKAQNP-------VVLYVSGGNTQ-VIAYSEKRYRIFGETLDIAIGNCLDRFARTLKI 202

  Fly   201 --HILPEYRLWNGGRAIEHAAQLASDPLAYEFPLPLAQQRNCNFSFAGI------------KNNS 251
              ...|.|.:....:...|...|.      |.|..:   :..:.|.:||            |.|.
Yeast   203 PNEPSPGYNIEQLAKKAPHKENLV------ELPYTV---KGMDLSMSGILASIDLLAKDLFKGNK 258

  Fly   252 FRAIRARERAERTPPDGVISNYGDFCAGLLRSVSRHLMHRTQRAIEYCLLPHRQLFGDTPPTLVM 316
            ...|    ..::|..:..:: ..|.|..|..::...|:..|:||:.:.         ::...|::
Yeast   259 KNKI----LFDKTTGEQKVT-VEDLCYSLQENLFAMLVEITERAMAHV---------NSNQVLIV 309

  Fly   317 SGGVANNDAIYANIEHLAAQYGCRS------FRPSKRYCSDNGVMIAWHGV 361
             |||..|    ..::.:.||. |:.      .....|:|.|||||||..|:
Yeast   310 -GGVGCN----VRLQEMMAQM-CKDRANGQVHATDNRFCIDNGVMIAQAGL 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14231NP_001245765.1 T6A_TsaD_YgjD 27..365 CDD:274748 88/376 (23%)
Carbam_trans_N 27..>156 CDD:304575 33/149 (22%)
KAE1NP_012964.2 PTZ00340 17..386 CDD:240369 88/376 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0533
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100288
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.