DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14231 and Osgep

DIOPT Version :9

Sequence 1:NP_001245765.1 Gene:CG14231 / 32982 FlyBaseID:FBgn0031060 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_598437.2 Gene:Osgep / 66246 MGIID:1913496 Length:335 Species:Mus musculus


Alignment Length:372 Identity:107/372 - (28%)
Similarity:158/372 - (42%) Gaps:61/372 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VLGIETSCDDTGIAIVDTTGRVIANVLESQQEFHTRYG-GIIPPRAQDLHRARIESAYQRCMEAA 90
            |||.|.|.:..|:.:| ..|.|:||   .::.:.|..| |.:|......|||.|....|..:..|
Mouse     4 VLGFEGSANKIGVGVV-RDGTVLAN---PRRTYVTAPGTGFLPGDTARHHRAVILDLLQEALTEA 64

  Fly    91 QLKPDQLTAIAVTTRPGL--PLSLLVGVRFARHLARRLQKPLLPVHHMEAHALQARM----EHPE 149
            .|....:..||.|..||:  ||:.:..|  ||.:|:...||||.|:|...|....|:    .:| 
Mouse    65 GLTSKDIDCIAFTKGPGMGSPLASVAVV--ARTVAQLWNKPLLGVNHCIGHIEMGRLITGAVNP- 126

  Fly   150 QIGYPFLCLLASGGHCQLVVANGPGRLTLLGQTLDDAPGEAFDKIGRRLRLHILPEYRLWNGGRA 214
                  ..|..|||:.| |::....|..:.|:|:|.|.|...|:..|.|::...|     :.|..
Mouse   127 ------TVLYVSGGNTQ-VISYSEHRYRIFGETIDIAVGNCLDRFARVLKISNDP-----SPGYN 179

  Fly   215 IEHAAQLASDPLAYEFPLPLAQQRNCNFSFAGIKNNSF---RAIRARERAERTPPDGVISNYGDF 276
            ||..|:....  ..|.|..:   :..:.||:||.  ||   .|.|.....|.||.        |.
Mouse   180 IEQMAKRGKK--LVELPYTV---KGMDVSFSGIL--SFIEDAAQRMLATGECTPE--------DL 229

  Fly   277 CAGLLRSVSRHLMHRTQRAIEYCLLPHRQLFGDTPPTLVMSGGVANNDAIYANIEHLAAQYGCRS 341
            |..|..:|...|:..|:||:.:|        |.....:|  |||..|..:...:..:..:.|.:.
Mouse   230 CFSLQETVFAMLVEITERAMAHC--------GSKEALIV--GGVGCNLRLQEMMGTMCQERGAQL 284

  Fly   342 FRPSKRYCSDNGVMIAWHGVEQL-------LQDKEASTRYDYDSIDI 381
            |...:|:|.|||.|||..|.|..       |:|...:.||..|.:::
Mouse   285 FATDERFCVDNGAMIAQAGWEMFQAGHRTPLKDSAITQRYRTDEVEV 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14231NP_001245765.1 T6A_TsaD_YgjD 27..365 CDD:274748 102/354 (29%)
Carbam_trans_N 27..>156 CDD:304575 42/135 (31%)
OsgepNP_598437.2 PTZ00340 4..335 CDD:240369 107/372 (29%)
Carbam_trans_N 4..>108 CDD:304575 37/109 (34%)
Substrate binding. /evidence=ECO:0000255|HAMAP-Rule:MF_03180 130..134 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0533
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100288
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.