DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14231 and OSGEP

DIOPT Version :9

Sequence 1:NP_001245765.1 Gene:CG14231 / 32982 FlyBaseID:FBgn0031060 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_060277.1 Gene:OSGEP / 55644 HGNCID:18028 Length:335 Species:Homo sapiens


Alignment Length:370 Identity:105/370 - (28%)
Similarity:154/370 - (41%) Gaps:57/370 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VLGIETSCDDTGIAIVDTTGRVIANVLESQQEFHTRYG-GIIPPRAQDLHRARIESAYQRCMEAA 90
            |||.|.|.:..|:.:| ..|:|:||   .::.:.|..| |.:|......|||.|....|..:..:
Human     4 VLGFEGSANKIGVGVV-RDGKVLAN---PRRTYVTPPGTGFLPGDTARHHRAVILDLLQEALTES 64

  Fly    91 QLKPDQLTAIAVTTRPGLPLSLLVGVRFARHLARRLQKPLLPVHHMEAHALQARM----EHPEQI 151
            .|....:..||.|..||:...|:.....||.:|:...|||:.|:|...|....|:    ..|   
Human    65 GLTSQDIDCIAYTKGPGMGAPLVSVAVVARTVAQLWNKPLVGVNHCIGHIEMGRLITGATSP--- 126

  Fly   152 GYPFLCLLASGGHCQLVVANGPGRLTLLGQTLDDAPGEAFDKIGRRLRLHILPEYRLWNGGRAIE 216
                ..|..|||:.| |:|....|..:.|:|:|.|.|...|:..|.|::...|     :.|..||
Human   127 ----TVLYVSGGNTQ-VIAYSEHRYRIFGETIDIAVGNCLDRFARVLKISNDP-----SPGYNIE 181

  Fly   217 HAAQLASDPLAYEFPLPLAQQRNCNFSFAGIKNNSF---RAIRARERAERTPPDGVISNYGDFCA 278
            ..|:....  ..|.|..:   :..:.||:||.  ||   .|.|.....|.||.        |.|.
Human   182 QMAKRGKK--LVELPYTV---KGMDVSFSGIL--SFIEDVAHRMLATGECTPE--------DLCF 231

  Fly   279 GLLRSVSRHLMHRTQRAIEYCLLPHRQLFGDTPPTLVMSGGVANNDAIYANIEHLAAQYGCRSFR 343
            .|..:|...|:..|:||:.:|        |.....:|  |||..|..:...:..:..:.|.|.|.
Human   232 SLQETVFAMLVEITERAMAHC--------GSQEALIV--GGVGCNVRLQEMMATMCQERGARLFA 286

  Fly   344 PSKRYCSDNGVMIAWHGVEQL-------LQDKEASTRYDYDSIDI 381
            ..:|:|.|||.|||..|.|..       |.|...:.||..|.:::
Human   287 TDERFCIDNGAMIAQAGWEMFRAGHRTPLSDSGVTQRYRTDEVEV 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14231NP_001245765.1 T6A_TsaD_YgjD 27..365 CDD:274748 100/352 (28%)
Carbam_trans_N 27..>156 CDD:304575 38/133 (29%)
OSGEPNP_060277.1 PTZ00340 4..335 CDD:240369 105/370 (28%)
Substrate binding. /evidence=ECO:0000255|HAMAP-Rule:MF_03180 130..134 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0533
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100288
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.