DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc42 and RHO1

DIOPT Version :9

Sequence 1:NP_001245762.1 Gene:Cdc42 / 32981 FlyBaseID:FBgn0010341 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_015491.1 Gene:RHO1 / 856294 SGDID:S000006369 Length:209 Species:Saccharomyces cerevisiae


Alignment Length:198 Identity:96/198 - (48%)
Similarity:131/198 - (66%) Gaps:11/198 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRP 69
            |.|:|||||.|||||||.::..:||..||||||:||...|.:.|....|.|:|||||||||||||
Yeast    12 KLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVFENYVADVEVDGRRVELALWDTAGQEDYDRLRP 76

  Fly    70 LSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVGTQIDLRDENSTLEKLAKNKQ 134
            ||||.::|.|:|||:..|.|.|||:|||:.|:.|.||..|.:|||.::|||::..|:|:|.:..|
Yeast    77 LSYPDSNVVLICFSIDLPDSLENVQEKWIAEVLHFCQGVPIILVGCKVDLRNDPQTIEQLRQEGQ 141

  Fly   135 KPITMEQGEKLAKELKAVKYVECSALTQKGLKNVFDEAILAALEPPEPT-----------KKRKC 188
            :|:|.::|:.:|.::.|..|.||||.|..|::.||:.|..|:|.....|           ||:||
Yeast   142 QPVTSQEGQSVADQIGATGYYECSAKTGYGVREVFEAATRASLMGKSKTNGKAKKNTTEKKKKKC 206

  Fly   189 KFL 191
            ..|
Yeast   207 VLL 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc42NP_001245762.1 Cdc42 3..177 CDD:206664 89/171 (52%)
RHO 6..179 CDD:197554 89/172 (52%)
RHO1NP_015491.1 RhoA_like 10..184 CDD:206662 89/171 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.