DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc42 and RAC3

DIOPT Version :9

Sequence 1:NP_001245762.1 Gene:Cdc42 / 32981 FlyBaseID:FBgn0010341 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001190916.1 Gene:RAC3 / 829654 AraportID:AT4G35020 Length:198 Species:Arabidopsis thaliana


Alignment Length:187 Identity:107/187 - (57%)
Similarity:139/187 - (74%) Gaps:4/187 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLR 68
            ||||.||||||||||||||||:|.||::||||||||::..|::.|....|||:||||||||:|||
plant     7 IKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVIVDGNTINLGLWDTAGQEDYNRLR 71

  Fly    69 PLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVGTQIDLRDENSTLEKLAKNK 133
            ||||...||||:.||:||.:|:|||.:|||||:.|:....|.:||||::||||:.   :..|::.
plant    72 PLSYRGADVFLLAFSLVSKASYENVSKKWVPELRHYAPGVPIILVGTKLDLRDDK---QFFAEHP 133

  Fly   134 -QKPITMEQGEKLAKELKAVKYVECSALTQKGLKNVFDEAILAALEPPEPTKKRKCK 189
             ..||:..|||:|.|.:.|..|:||||.||:.:|.|||.||...|:||:..||:|.|
plant   134 GAVPISTAQGEELKKLIGAPAYIECSAKTQQNVKAVFDAAIKVVLQPPKNKKKKKRK 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc42NP_001245762.1 Cdc42 3..177 CDD:206664 100/173 (58%)
RHO 6..179 CDD:197554 99/173 (57%)
RAC3NP_001190916.1 Rop_like 6..178 CDD:206705 100/173 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 231 1.000 Domainoid score I651
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 237 1.000 Inparanoid score I1099
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 1 1.000 - - FOG0000070
OrthoInspector 1 1.000 - - mtm1108
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X103
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.