DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc42 and cdc42l

DIOPT Version :9

Sequence 1:NP_001245762.1 Gene:Cdc42 / 32981 FlyBaseID:FBgn0010341 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_956159.1 Gene:cdc42l / 793158 ZFINID:ZDB-GENE-030131-6069 Length:191 Species:Danio rerio


Alignment Length:191 Identity:167/191 - (87%)
Similarity:183/191 - (95%) Gaps:0/191 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYD 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Zfish     1 MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYD 65

  Fly    66 RLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVGTQIDLRDENSTLEKLA 130
            ||||||||||||||||||||||||||||||||||||:|||.:|||||||||:||||:::|:||||
Zfish    66 RLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEISHHCPRTPFLLVGTQVDLRDDSNTVEKLA 130

  Fly   131 KNKQKPITMEQGEKLAKELKAVKYVECSALTQKGLKNVFDEAILAALEPPEPTKKRKCKFL 191
            ||||:||:.|.||||:::|:||||||||||||:||||||||||||||||||...|::|..|
Zfish   131 KNKQRPISPESGEKLSRDLRAVKYVECSALTQRGLKNVFDEAILAALEPPETKPKKRCVLL 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc42NP_001245762.1 Cdc42 3..177 CDD:206664 156/173 (90%)
RHO 6..179 CDD:197554 155/172 (90%)
cdc42lNP_956159.1 Cdc42 3..177 CDD:206664 156/173 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575710
Domainoid 1 1.000 331 1.000 Domainoid score I1125
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H123986
Inparanoid 1 1.050 359 1.000 Inparanoid score I2175
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 1 1.000 - - FOG0000070
OrthoInspector 1 1.000 - - otm25889
orthoMCL 1 0.900 - - OOG6_104797
Panther 1 1.100 - - O PTHR24072
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X103
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.760

Return to query results.
Submit another query.