DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc42 and Rhobtb1

DIOPT Version :9

Sequence 1:NP_001245762.1 Gene:Cdc42 / 32981 FlyBaseID:FBgn0010341 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001074816.1 Gene:Rhobtb1 / 69288 MGIID:1916538 Length:695 Species:Mus musculus


Alignment Length:202 Identity:79/202 - (39%)
Similarity:116/202 - (57%) Gaps:30/202 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEY------VPTVF--DNYAVTV--------MIGGE 49
            ::|||||||||.|||||.|:.:...|...::|      ||||:  |.|.|..        ::...
Mouse    12 VETIKCVVVGDNAVGKTRLICARACNTTLTQYQLLATHVPTVWAIDQYRVCQEVLERSRDVVDEV 76

  Fly    50 PYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVG 114
            ..:|.|:||.|  |:.:.|..:|.::||.::|||:.:|:|..:||..|..||.|.|.:||.:|||
Mouse    77 SISLRLWDTFG--DHHKDRRFAYGRSDVVVLCFSIANPNSLNHVKTMWYQEIKHFCPRTPVVLVG 139

  Fly   115 TQIDLRDENSTLEKLAKNKQ---KPITM------EQGEKLAKELKAVKYVECSALTQKGLKNVFD 170
            .|:|||  .:.||.:.:.::   :||..      |:|.::|||| .:.|.|.|...|.|:|:|||
Mouse   140 CQLDLR--YADLEAVNRARRPLARPIKRGDILPPEKGREVAKEL-GIPYYETSVFDQFGIKDVFD 201

  Fly   171 EAILAAL 177
            .||.|||
Mouse   202 NAIRAAL 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc42NP_001245762.1 Cdc42 3..177 CDD:206664 77/198 (39%)
RHO 6..179 CDD:197554 76/197 (39%)
Rhobtb1NP_001074816.1 Rho-like 1..210 79/202 (39%)
RhoBTB 13..207 CDD:133275 76/198 (38%)
BTB_POZ 248..459 CDD:365784
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 325..351
BTB_POZ 464..589 CDD:365784
BACK_RHOBTB1 592..691 CDD:350605
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.