Sequence 1: | NP_001245762.1 | Gene: | Cdc42 / 32981 | FlyBaseID: | FBgn0010341 | Length: | 191 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001074816.1 | Gene: | Rhobtb1 / 69288 | MGIID: | 1916538 | Length: | 695 | Species: | Mus musculus |
Alignment Length: | 202 | Identity: | 79/202 - (39%) |
---|---|---|---|
Similarity: | 116/202 - (57%) | Gaps: | 30/202 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEY------VPTVF--DNYAVTV--------MIGGE 49
Fly 50 PYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVG 114
Fly 115 TQIDLRDENSTLEKLAKNKQ---KPITM------EQGEKLAKELKAVKYVECSALTQKGLKNVFD 170
Fly 171 EAILAAL 177 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Cdc42 | NP_001245762.1 | Cdc42 | 3..177 | CDD:206664 | 77/198 (39%) |
RHO | 6..179 | CDD:197554 | 76/197 (39%) | ||
Rhobtb1 | NP_001074816.1 | Rho-like | 1..210 | 79/202 (39%) | |
RhoBTB | 13..207 | CDD:133275 | 76/198 (38%) | ||
BTB_POZ | 248..459 | CDD:365784 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 325..351 | ||||
BTB_POZ | 464..589 | CDD:365784 | |||
BACK_RHOBTB1 | 592..691 | CDD:350605 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0393 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |