DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc42 and Rhof

DIOPT Version :9

Sequence 1:NP_001245762.1 Gene:Cdc42 / 32981 FlyBaseID:FBgn0010341 Length:191 Species:Drosophila melanogaster
Sequence 2:XP_001073389.2 Gene:Rhof / 690130 RGDID:1584038 Length:211 Species:Rattus norvegicus


Alignment Length:192 Identity:85/192 - (44%)
Similarity:125/192 - (65%) Gaps:4/192 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLR 68
            :|.|:||||..|||.||:.|....||..|.|:||:.|..:|.:|.:..||.|:||||||||||||
  Rat    20 LKIVIVGDGGCGKTSLLMVYCQGSFPEHYAPSVFEKYTASVTVGNKEVTLNLYDTAGQEDYDRLR 84

  Fly    69 PLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVGTQIDLRDENSTLEKLAKNK 133
            ||||..|.:.|:|:.|::|:|::||..||.||:||.|:..|.:|:|.:.|||.:...|.||...:
  Rat    85 PLSYQNTHLVLICYDVMNPTSYDNVLIKWFPEVTHFCRGIPMVLIGCKTDLRKDKEQLRKLRAAQ 149

  Fly   134 QKPITMEQGEKLAKELKAVKYVECSALTQKGLKNVFDEA---ILAALEPPEPTKKRK-CKFL 191
            .:|||..||....::::...|:||||..::.:::||.||   .|:||:..:..||:: |..|
  Rat   150 LEPITYTQGLSACEQMRGALYLECSAKFRENVEDVFREATKVALSALKKAQRQKKQRICLLL 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc42NP_001245762.1 Cdc42 3..177 CDD:206664 79/175 (45%)
RHO 6..179 CDD:197554 80/175 (46%)
RhofXP_001073389.2 Rho4_like 17..211 CDD:206704 84/190 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.