DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc42 and rhof

DIOPT Version :9

Sequence 1:NP_001245762.1 Gene:Cdc42 / 32981 FlyBaseID:FBgn0010341 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001018478.1 Gene:rhof / 573655 ZFINID:ZDB-GENE-050522-280 Length:209 Species:Danio rerio


Alignment Length:193 Identity:86/193 - (44%)
Similarity:118/193 - (61%) Gaps:5/193 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLR 68
            :|.|:||||..|||.||:.|....||.:|.|:|||.|..||..||:...|.|:||||||||||||
Zfish    17 LKIVIVGDGGCGKTSLLMVYAKGDFPEKYAPSVFDKYVTTVSYGGKDIQLNLYDTAGQEDYDRLR 81

  Fly    69 PLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVGTQIDLRDENSTLEKLAKNK 133
            ||||...::.|:|:.|.:|:||:|||.||.||:.|.|:..|.:|:..:.|||.:...:.:|....
Zfish    82 PLSYQDVNIVLICYDVTNPTSFDNVKIKWYPEVRHFCRDAPIILISCKTDLRKDKEKMRRLKALD 146

  Fly   134 QKPITMEQGEKLAKELKAVKYVECSALTQKGLKNVFDEAILAALEP-----PEPTKKRKCKFL 191
            |.|||...||:..||:.|..|:||||..::.::::|.||...||..     ....||:.|..|
Zfish   147 QAPITYLLGEQTQKEMNAEIYLECSAKYRENVEDIFREATKRALAARAKARHRSKKKKHCTVL 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc42NP_001245762.1 Cdc42 3..177 CDD:206664 80/172 (47%)
RHO 6..179 CDD:197554 81/172 (47%)
rhofNP_001018478.1 P-loop_NTPase 17..209 CDD:304359 85/191 (45%)
RHO 19..186 CDD:197554 78/166 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.