DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc42 and cdc42l2

DIOPT Version :9

Sequence 1:NP_001245762.1 Gene:Cdc42 / 32981 FlyBaseID:FBgn0010341 Length:191 Species:Drosophila melanogaster
Sequence 2:XP_021325487.1 Gene:cdc42l2 / 556226 ZFINID:ZDB-GENE-060312-21 Length:209 Species:Danio rerio


Alignment Length:188 Identity:142/188 - (75%)
Similarity:157/188 - (83%) Gaps:6/188 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYD 65
            |.|||||||||.||||||||:|: |||||||  ||||:..:||||:||||||:.||:.|||   |
Zfish    25 MSTIKCVVVGDEAVGKTCLLVSF-TNKFPSE--PTVFNTQSVTVMMGGEPYTIRLFNAAGQ---D 83

  Fly    66 RLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVGTQIDLRDENSTLEKLA 130
            :||||:|||||||||||||||.|||||||||||||||.:..|||||||||||||||:..|:.:||
Zfish    84 QLRPLNYPQTDVFLVCFSVVSLSSFENVKEKWVPEITFYAPKTPFLLVGTQIDLRDDPVTVARLA 148

  Fly   131 KNKQKPITMEQGEKLAKELKAVKYVECSALTQKGLKNVFDEAILAALEPPEPTKKRKC 188
            |||||||..|..||||:||||||||||||||.|||||||||||||||:|.......||
Zfish   149 KNKQKPIKPEAAEKLARELKAVKYVECSALTLKGLKNVFDEAILAALQPSGSQNTCKC 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc42NP_001245762.1 Cdc42 3..177 CDD:206664 136/173 (79%)
RHO 6..179 CDD:197554 135/172 (78%)
cdc42l2XP_021325487.1 P-loop_NTPase 27..195 CDD:328724 136/173 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 1 1.000 - - FOG0000070
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24072
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.