DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc42 and si:ch211-133l11.10

DIOPT Version :9

Sequence 1:NP_001245762.1 Gene:Cdc42 / 32981 FlyBaseID:FBgn0010341 Length:191 Species:Drosophila melanogaster
Sequence 2:XP_005160216.1 Gene:si:ch211-133l11.10 / 555552 ZFINID:ZDB-GENE-141219-14 Length:262 Species:Danio rerio


Alignment Length:188 Identity:96/188 - (51%)
Similarity:128/188 - (68%) Gaps:10/188 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQ------- 61
            :|||:|||||||||.|:||||||.:|:|::||.|||:...|::.|.|..|.|.|.|||       
Zfish    37 VKCVMVGDGAVGKTSLIISYTTNGYPAEHIPTAFDNFTARVVVDGRPVQLQLCDMAGQRWEAVDQ 101

  Fly    62 ---EDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVGTQIDLRDEN 123
               :|:||||||.|...||||:|:|||.||||.:|.::|.|||...|...|.:|||||.||.::.
Zfish   102 SLNDDFDRLRPLCYRDADVFLLCYSVVLPSSFRSVTDRWAPEINRICPGVPIILVGTQCDLLEDV 166

  Fly   124 STLEKLAKNKQKPITMEQGEKLAKELKAVKYVECSALTQKGLKNVFDEAILAALEPPE 181
            ..|.:||:.::||::.|.....|:.:.||.:.||||||||.||.|||.||||:::..|
Zfish   167 QVLIRLAEGQEKPVSQEDARLCARSIGAVTFAECSALTQKNLKEVFDAAILASMKHAE 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc42NP_001245762.1 Cdc42 3..177 CDD:206664 95/182 (52%)
RHO 6..179 CDD:197554 94/182 (52%)
si:ch211-133l11.10XP_005160216.1 Wrch_1 37..219 CDD:133330 94/181 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 1 1.000 - - FOG0000070
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.